high vision javcensored various occupations jav




FC2AMBISDABHUNTBDTTSANFSDSSJUFEMEYDSPRDCHRVMIAASSNIPREDPPPDROYDLULUHNDIPXDASDWANZ

2020-11-27
258 min

[NATR-646]Totally! Ayako Kano

  • ayako kano censoredmature womanNATRpinknadeshikoNATR-646NATR646h-067natr00646
    • 2020-11-27
    60 min

    [WKD-036]Provocative Interview Room in USA Scarlet May

  • scarlet may censoredcreampiesingle workWKDwaap entertainmentk westwWKD-036WKD0362wkd00036
    • 2020-12-10
    60 min

    [GRKG-004]ニンゲン観察 宅呑みしていた男女4人が性欲に負け同じ部屋でそれぞれに見られながらの倒錯セックス

  • censoredGRKGkageki chleo hakusanGRKG-004GRKG004h-1535grkg00004
    • 2020-12-12
    139 min

    [JUFE-232]Rena's Eyes Never Leave You With This Exclusively POV Footage! My Stepsister's In Love With Me And We Fuck Everywhere In The House - Sweaty Sex And The Absolute Temptation Of Her Colossal TIts! Rena Momozono

  • reina taoyuan censoredbig titssisterJUFEfitchJUFE-232JUFE232jufe00232
    • 2020-12-13
    41 min

    FC2PPV 1605469 [Uncensored] Sakura-chan, who is about to graduate ☆ Unearthed thing Part5‼ Icharab SEX was supposed to be a senior intrusion and a 3P continuous live party ♡ [Luxury purchase privilege available]

  • amateur uncensoredfc2
    • 2020-12-25
    239 min

    [YTR-150]Kotone Toa - Total Coverage - 4 Hours Of Fucking

  • toua kotone censoredcreampiedeepthroatYTRnonYTR-150YTR150h-127ytr00150
    • 2021-01-10
    48 min

    10musume 011021_01 Girl who can only be seen seriously was actually a nasty pervert FUJIKANA

  • amateur uncensored10musume
    • 2021-01-23
    239 min

    [REXD-350]Possessed Residents - Homes Haunted By Girl Ghosts "I Want To Be Fucked By Huge Cocks!"

  • censoredcreampieREXDredmanji groupREXD-350REXD350rexd00350
    • 2021-01-24
    119 min

    [BLOR-161]This Cute Thirty-Something Lady Works At A D**gstore And She Turned Out To Be A Soft And Gentle, Kansai-Dialect-Speaking Lady With Amazing Techniques Who Transformed Into A Serious Slut When I Fucked Her With My Big Cock!

  • censoredBLORbroccoli mousouzokubroccoliBLOR-161BLOR161blor00161
    • 2021-01-28
    60 min

    H0930 ki210128 Saeko Hamaoka 28years old

  • amateur uncensoredh0930
    • 2021-01-30
    41 min

    FC2PPV 1665998 [Individual shooting] Saddle a junior sister and vaginal cum shot! I didn’t know and ran away …

  • amateur uncensoredfc2
    • 2021-02-04
    73 min

    200GANA-2430 Seriously Nampa, first shot. 1592 An elegant and glamorous beauty with a packer on the chest! A beautiful witch who has too many secrets is hard to wash in sex and puts out herself! ？？ Get drunk with the bewitching and elegant Karami!

  • amateur censoredbig titsamateurganagana-2430gana2430200gana-2430
    • 2021-02-11
    167 min

    [NHDTB-493]Reverse NTR A Slippery And Slimy Threesome Fuck Fest Involving Your Wife When Your Wife Caught Your Married Dick Pumping Away At This Girl And Giving Her Creampie Sex, She Got Dripping Wet With Jealousy And Decided To Join In The Fun.

  • censoredcreampiebig titsNHDTBnatural highbacon tanakaNHDTB-493NHDTB4931nhdtb00493
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    119 min

    [MIAA-389]Super Luxury Creampie Specialty Soapland Momo Kato

  • kato momoka censoredcreampiebig titsMIAAmoodyzhirokoji osakieveryone s porn starMIAA-389MIAA389miaa00389
    • 2021-02-25
    107 min

    [SPRD-1381]So Much Better Than My Husband's... - Hitomi Hitachi

  • hitachi hitomi censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1381SPRD138118sprd01381
    • 2021-02-25
    15 min

    10musume 022521_01 Secret Pussy Collection: Keiko Miyahara

  • amateur uncensored10musume
    • 2021-02-27
    240 min

    [FSPT-009]10 Loads In A Row Creampie: Youthful And Fiery, 10 People, 240 Min.

  • censoredbig titsschoolgirlFSPTfirst starpeachteenFSPT-009FSPT009h-491fspt00009
    • 2021-02-28
    105 min

    [VENX-012]2 Days And 1 Night Spent With My Wife's Sister Who Suddenly Came On To Me - Natsuho Imai

  • natsuho imai censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-012VENX012venx00012
    • 2021-03-06
    129 min

    [BF-626]A Perverted Oil Massage Therapist With A Beautiful Y********l In Uniform - Toai Nanami

  • toai nanami censoredbeautiful girlsingle workBFbefreeBF-626BF626bf00626
    • 2021-03-06
    170 min

    [HUNBL-036]You Chased Away My Beloved Stepmom, So I'm Never Going To Forgive You! When My Dad Got Remarried, I Fucked My New Stepmom And Big Sister-In-Law And Filmed It POV Style, And Everyone Said, "Your Family Is Pretty Fucked Up ..."

  • censoredcreampiesisterHUNBLhunteraldebaranhhh groupHUNBL-036HUNBL036hunbl00036
    • 2021-03-06
    62 min

    Pacopacomama 030621_443 Mature Beauty Without Makeup: A mid-age woman who looks amazing without makeup Ryoko Asamiya

  • amateur uncensoredpacopacomama
    • 2021-03-15
    48 min

    492MERC-249 Former Ekiden player. 2

  • amateur censoredcreampieamateurmercmerc-249merc249492merc-249
    • 2021-03-16
    142 min

    1Pondo 031621_001 Mio Futaba : Mio Futaba Special Edition

  • amateur uncensored1pondo
    • 2021-03-19
    117 min

    [BST-020]A Woman Goes On A Solo Trip To Go Hunting Cherry Boys Ryo Fukutomi

  • censoredamateurbeautiful girlBSTrubysuke kato 6boston bagBST-020BST020118bst00020
    • 2021-03-22
    128 min

    [HOMA-103]

  • mahiro ichiki censoredschoolgirlbeautiful girlHOMAh m p doramajo asagiriHOMA-103HOMA103homa00103
    • 2021-04-09
    117 min

    [XRW-993]Moaning And Choking While Deep Throating In A Kat Suit Full Bondage Sex

  • tsugumi mizusawa aimi censoredXRWreal worksreal real worksXRW-993XRW993xrw00993
    • 2021-04-15
    123 min

    [BBTU-010]You'll Swoon With Pleasure! Breast Oil Massage, Slow Titty Fuck & Slow Sex Yuria Yoshine

  • yoshine yuria censoredbig titsblowjobBBTUdogmatenunmy boyneBBTU-010BBTU010bbtu00010
    • 2021-04-28
    19 min

    FC2PPV 1790527 [4K] [Individual shooting] First appearance! Kawasaki City, Daddy Active Girls Sena-chan 20 Years Old Gonzo Raw Saddle Production!

  • amateur uncensoredfc2
    • 2021-05-02
    110 min

    [AED-193]Family Fucking Fucking My 50 Something Step Mother Raw Yukie Mizukami

  • yukie mizukami censoredmature womansingle workAEDrubysusumu yanokuchieden rubyAED-193AED193aed00193
    • 2021-05-02
    169 min

    [SORA-310]H.K. (Age 23) Is A Wild Masochist Slut Working At An Ikebukuro Girls Bar. (Submissive Exhibitionist Tied Up Outside For Public Orgasms) (Embarrassing Ecstasy So Intense She Wets Herself) (Her Shaved Pussy Swallows Huge Cocks Whole In A Five

  • censoreddeepthroatSORAyama to sorahimu lockSORA-310SORA310sora00310
    • 2021-05-21
    120 min

    [HZGD-188]

  • kato camellia censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-188HZGD188h-1100hzgd00188
    • 2021-05-29
    130 min

    [ARAN-022]The Strong Orgasms After Having Sex With You Research Center A Female Bodily Transformation Project Using Secret Sexual Toys And Authentic Aphrodisiacs Project-2 We Met This Office Lady Who Works At A Financial Firm At A Bar So We Seduced H

  • censoredcreampieARANbabyentertainmentshiroto musume kyoso kyokuARAN-022ARAN022aran00022
    • 2021-06-19
    117 min

    [NNPJ-456]Real Life College Girl Willing To Take 6 Creampie Loads For A Job Offer - Karen, F-Cup

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-456NNPJ456nnpj00456
    • 2021-06-20
    87 min

    [KIR-037]My Big Titty, Glasses-Wearing Step Sister Is A Comic Book Artist With A Voice Like An Anime Girl, And She Came To Me For Advice On How To Draw Sex Scenes... Yuki Makimura

  • yuki makimura censoredcreampiesisterKIRstar paradisekirei star paradiseKIR-037KIR037h-254kir00037
    • 2021-06-22
    135 min

    [KIRE-040]Extremely pretty! Starring both Akane Soma and Mariko Sata A blowjob-crazy housewife orders food, seduces the young delivery guy, and pulls away during successive ejaculations! 8 cum shots in total

  • mariko sada soma censoredcreampiemature womanKIREsod createsakai shiberiarei kirei sodKIRE-040KIRE0401kire00040
    • 2021-07-30
    148 min

    [JUL-676]I Met My Teacher Again As A Callgirl -Ai Mukai

  • ai mukai censoredmature womansingle workJULmadonnakitorune kawaguchiJUL-676JUL676jul00676
    • 2021-08-28
    65 min

    383REIW-092 Noa

  • amateur censoredcreampieamateurreiwreiw-092reiw092383reiw-092
    • 2021-09-03
    154 min

    [MIFD-175]Newcomer, First Place In The Beautiful Skin Grand Prix In Ishikawa Prefecture! Cute Baby With Skin Age of 3 Years Old Faith Beautiful Girl With Beautiful Skin And Heart AVdebut Mirai Yagami

  • yagami future censoredblowjobbeautiful girlMIFDmoodyzusapyonmoodyz freshMIFD-175MIFD175mifd00175
    • 2021-09-04
    55 min

    Caribbeancom 090421-001 Adult Kindergarten: A Student Has Sex With Big Tit Teacher Honoka Orihara

  • honoka orihara uncensoredhandjobcaribbeancom
    • 2021-09-15
    61 min

    Caribbeancom 091521-001 Fascinated By Cleaning Lady’s Booty So I Can’t Keep Calm! Kurumi Kokoro

  • kurumi kokoro uncensoredcreampiecaribbeancom
    • 2021-09-17
    62 min

    FC2PPV 2213573 [Uncensored] Tokyo Metropolitan Nursing / Nurse Clothes Creampie Raw Gonzo! 19 Years Old: Nursing Student

  • amateur uncensoredfc2
    • 2021-09-24
    199 min

    [HUNTB-101]"We"re Not Letting You Go To Sleep Yet!" - Two Sexy Female Bosses With Big Tits Trap Their Coworker In A Sex Sandwich And Fuck Him Until Morning! 2

  • censoredcreampieblowjobHUNTBhunterkonnyaku kannohhh groupHUNTB-101HUNTB101huntb00101
    • 2021-10-07
    63 min

    476MLA-053 The Ban On Raw Squirrels Has Been Lifted With The Debut Of Daddy Activity! !! "Raw Ji Po Feeling Good !!!" Unauthorized Mouth Firing And Vaginal Cum Shot 2nd Round To The Instructor Of The Screaming Punipuni Body! !! (Amu Ohara)

  • amateur censoredcreampiebig titsmlamla-053mla053476mla-053
    • 2021-10-07
    49 min

    H0930 ki211007 Shinobu Amano 33years old

  • amateur uncensoredh0930
    • 2021-10-12
    241 min

    [KTRA-340]Kotone Fuyuai PREMIUM Best 4 Hours

  • toua kotone censoredbeautiful girlKTRAk tribeKTRA-340KTRA340h-094ktra00340
    • 2021-10-15
    82 min

    259LUXU-1494 Luxury TV 1470 A Beautiful Medical Student Who Is Unfamiliar With Sex From An Environment That Grew Up In A Serious And Overprotected Family Appears On AV! When She Is Gently Caressed By An Inexperienced Body, She Gradually Becomes Encha

  • amateur censoredbig titsamateurluxuluxu-1494luxu1494259luxu-1494
    • 2021-11-20
    55 min

    H0930 tk0046 Yukari Ichise 30years old

  • amateur uncensoredh0930
    • 2021-12-03
    124 min

    [ADN-356]It"s Almost Been 5 Years Since This Horny Father-In-Law Started Sexual Relations With A Son"s Wife Iroha Natsume

  • natsume saiharu censoredcreampiesingle workADNattackersdoragon nishikawaotona no dramaADN-356ADN356adn00356
    • 2021-12-10
    198 min

    [URE-075]Super Class And Exclusive Rena Kodama x A Mature Woman Comic Original Story: Tamago The Gambit Of Destruction - Beyond Agony And Pleasure, A Female Teacher Married Woman Chose The Worst Possible Situation -

  • kodama rena censoredmature womansingle workUREmadonnakitorune kawaguchiure.comiURE-075URE075ure00075
    • 2021-12-18
    63 min

    H0930 tk0048 Akiko Maekado 29years Old

  • amateur uncensoredh0930
    • 2021-12-19
    50 min

    229SCUTE-1163 Hana (22) S-Cute Boyfriend Hana, Full Of Desire For Sex After A Long Absence (Hana Himesaki)

  • amateur censoredbig titsamateurscutescute-1163scute1163229scute-1163
    • 2022-01-01
    46 min

    491TKWA-209 5 Koharu Hanasaki Put Out In This Daughter

  • amateur censoredcreampieuniformtkwatkwa-209tkwa209491tkwa-209
    • 2022-01-15
    129 min

    [GMEM-055]A Masochistic Wife With A Huge Ass Awakens To Her Lewd Desires With A Whip Installation And Becomes A Dutch Wife

  • censoredbukkakeGMEMavsbuddha davscollector s goldGMEM-055GMEM055gmem00055
    • 2022-01-20
    124 min

    [HDKA-249]The Naked Maid The Nude Maid Referral Center Rino Yuki

  • yuki rino censoredcreampiebig titsHDKAplanet plusdirector orafu shukouHDKA-249HDKA249h-237hdka00249
    • 2022-01-28
    109 min

    [RBK-037]An Atrocious Slut Market. Ena Satsuki

  • ena satsuki censoredsingle workRBKattackersyu mabukiryupakuRBK-037RBK037rbk00037



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored