high vision post javcensored jav censored




FC2HNDDTTMIDEHMNRBDSANWAAAHDKAMILKADNMEYDCHRVVENUPPPDJULCAWDMIAAJUFEMIDVSDAB

2020-09-17
119 min

[OKSN-300]The Pleasure Of Sex Tempting And Filthy Big Tits And Areolas You Can Fuck Me All You Want...

  • censoredbig titsOKSNabc mousouzokuokasan.comOKSN-300OKSN300oksn00300
    • 2020-09-19
    48 min

    FC2PPV 1507830 [Personal shooting] Akari 20-year-old maid cafe clerk ★ Twin tail Moe Moe beauty is an anime voice М woman! I will make a large amount of vaginal cum shot in the pussy of shaved bread!

  • amateur uncensoredfc2
    • 2020-09-29
    242 min

    [ZOOO-005]20 Exquisite Bodies - These Beautiful Tits Would Turn Anybody's Head 240 Minutes

  • aika erika censoredbig titsZOOOzoooZOOO-005ZOOO005h-1515zooo00005
    • 2020-10-03
    57 min

    10musume 100320_01 The Structure Of Woman: Can you rescale again when I grown up？ Yui Asakawa

  • amateur uncensored10musume
    • 2020-10-06
    52 min

    S-Cute pok_005 Gonzo H / Rika wearing a small swimsuit on a big pie girl

  • rika censoredamateurpokpok-005pok005pok-005
    • 2020-10-08
    48 min

    [gerk-311]ゆい

  • amateur censoredcreampieamateurgerkgerk-311gerk311gerk-311
    • 2020-10-11
    116 min

    [BAHP-052]AV Footage Tricking The Kinda Girls Who You'd Like To Fuck! Rika Yamamoto Continually Climaxes, Overwhelming Her Sensitive Body

  • yamamoto renka censoredblowjobsingle workBAHPbaltanminimal iwamurahoppinBAHP-052BAHP052bahp00052
    • 2020-10-11
    66 min

    398CON-081 Kurosawa Yuki (42)

  • amateur censoredcreampieamateurconcon-081con081398con-081
    • 2020-10-15
    352 min

    [VOV-065]A Massive Collection Of Gal Babes And Big Tits! A Nampa Seduction Chain Reaction Sex Party 05

  • censoredcreampiebig titsVOVit s thursday everyone gather upshake your hips as much as you wantVOV-065VOV065h-1350vov00065
    • 2020-10-17
    55 min

    FC2PPV 1537582 [Personal shooting] Sayaka 25-year-old office lady ★ Black-haired baby-faced neat and clean sister! Plenty of vaginal cum shot in a slippery pie bread pussy!

  • amateur uncensoredfc2
    • 2020-10-21
    46 min

    330PER-321 Miyoshi (28)

  • amateur censoredamateurperper-321per321330per-321
    • 2020-10-23
    78 min

    [hoi-137]豊田さん(23)

  • amateur censoredamateurbeautiful girlhoihoi-137hoi137hoi-137
    • 2020-10-23
    103 min

    [YST-231]We Thought This Plain Jane, Prim And Proper Y********l Was Absolutely Inexperienced With Men, But It Turns Out She's A Totally Naive Horny Bitch Who Is Used To Being Used And Panting And Moaning Like A Cunt And Doesn't Realize That S

  • rion izumi censoredcreampieamateurYSTkomyoYST-231YST231540yst00231
    • 2020-10-24
    106 min

    [BSTC-048]マッチングアプリで出会ったドスケベなFカップくびれメガネ女子

  • censoredbig titsamateurBSTCboston clubBSTC-048BSTC048h-1117bstc00048
    • 2020-11-13
    106 min

    [KIMU-014]I Met My Crush Again At A Class Reunion... Cheating Creampie Sex In Public! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredsingle workdramaKIMUavs collector shiroyukifresh babe avs collector sKIMU-014KIMU014kimu00014
    • 2020-11-13
    161 min

    [IPX-568]My Girlfriend's Also My Boss - And She Loves My Rod More Than Anything Else. Passionate, Superb Sex, Day After Day. (Popular Series Volume 2) "Do You Love Me With No Makeup On...？" Nanami Misaki

  • nanami misaki censoredcreampieblowjobIPXidea pocketkyoseidishIPX-568IPX568ipx00568
    • 2020-11-19
    237 min

    [HUNTA-893]"Damn Girl How Horny Are You...？!" My Coworker's Normally Not Sexy At All But After A Little Liquor Her Lust Is Off The Charts!

  • censoredcreampieHUNTAhuntercognac kaminohhh groupHUNTA-893HUNTA893hunta00893
    • 2020-11-22
    228 min

    [REXD-344]Sexual Relations From Voyeur Photographs Married Women Coerced Into Going Home! "Our Relationship...I'm Sure You Don't Want Your Husband To Find Out"

  • censoredcreampiebig titsREXDredmanji groupREXD-344REXD344rexd00344
    • 2020-11-23
    146 min

    [AGAV-039]Totally Caught On Tape At Home! Experiencing Living Together With Saki Misami Is Too Obscene And Will Make You Want To Marry Her - Saki Misami

  • saki mizumi censoredblowjobsingle workAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-039AGAV039agav00039
    • 2020-12-12
    150 min

    [EBOD-784]Busty Pre-School Teacher Can't Resist Servicing Her S*****ts' Daddies' Dicks! Her Big Tits Bounce With A Smile In This E-BODY Exclusive Debut - Don't Tell The Little Ones How Hard She Cums - Squirting In Her First Film! Kaor

  • momota kaori censoredbig titssquirtingEBODe bodytrendy yamaguchiEBOD-784EBOD784ebod00784
    • 2020-12-24
    109 min

    [GS-368]There's Nowhere To Look - Office Girls Turn Guys On With Their Itty Bitty Miniskirts!

  • censoredGSsosoru x garconred ballGS-368GS3681gs00368
    • 2020-12-31
    66 min

    Caribbeancom 123120-001 Non stop orgy! Cum on guys! Emiri Miura

  • emiri miura uncensoredcreampiehandjobcaribbeancom
    • 2021-01-22
    240 min

    [MBM-266]mpo.jp Presents The Nonfiction Amateur Nampa Seductions Divine Best Hits Collection (Time-Saving Quickie Fucks Featuring Prematurely Ejaculating Ladies) 12 Ladies 4 Hours

  • censoredsquirtingamateurMBMprestigempo selection.committeembmMBM-266MBM266118mbm00266
    • 2021-01-27
    63 min

    230OREC-687 Suzuka

  • amateur censoredcreampieamateurorecorec-687orec687orec-687
    • 2021-01-31
    160 min

    [LULU-055]Horny Sex Monster MILF Covets Her Son's Friend's Cock - Lusty Mama With Colossal Tits Wrings Out Every Last Drop Of His Seed Chitose Yuki

  • chitose in the evening censoredcreampiebig titsLULUlunaticsluminaxLULU-055LULU055lulu00055
    • 2021-01-31
    126 min

    [JJBB-003]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 03

  • censoredcreampiemature womanJJBBjukujo japanJJBB-003JJBB003jjbb00003
    • 2021-02-09
    74 min

    FC2PPV 1678688 * Unauthorized vaginal cum shot Shaved Loli anime voice beautiful girl NTR ♥ Boyfriend’s uterus skewered piston does not reach reason collapse agony acme ♥ A large amount of cheating semen is poured on a dangerous day pussy and cu

  • amateur uncensoredfc2
    • 2021-02-18
    70 min

    [AKDL-087](Tokyo Girls) She's Performing In This Video While On Her Way Home From Work! A Horny Office Lady Who Loves To Suck Dick Late At Night She Suddenly Begged For A Threesome # A Maso Bitch # She Loves To Suck Dick # Instant Spasmic Orgasms

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-087AKDL0871akdl00087
    • 2021-02-19
    204 min

    [DOCP-275]Insta Fuck! I Couldn't Resist My Nurse's Sexy Ass! This Big Booty Nympho Was Horny For Creampie Sex And Came Hard On My Rod!

  • tsukino sakura nozomi higashi censoredcreampieuniformDOCPprestigedoc premiumDOCP-275DOCP275118docp00275
    • 2021-02-19
    130 min

    [SKEJ-006]A Pure Beautiful Girl With Black Hair!! Employee At A Family Restaurant Natsuki-chan

  • censoredcreampiebeautiful girlSKEJamateur time delusion groupSKEJ-006SKEJ006skej00006
    • 2021-02-19
    42 min

    480FRIN-020 《Personal shooting》 H cup Former famous opera troupe belonging to a beautiful stage actress SEX video leaked Variety show appearance

  • amateur censoredamateurfrinfrin-020frin020480frin-020
    • 2021-03-20
    61 min

    HEYZO 2481 Masochistic Slut -Married Bitch Giving Her Husband The Cold Shoulder- – Rena

  • rena uncensoredcreampieheyzo
    • 2021-03-20
    180 min

    [OFKU-178]The Bride's Mother Was Beautiful And Sexy For A Forty-Something Lady, And Her Son-In-Law Got Hot And Horny For Her Ripened Body And Popped His Cock In Raw 180 Minutes

  • kana suruga fukuyama iroha censoredcreampieblowjobOFKUstar paradisemom railOFKU-178OFKU178h-254ofku00178
    • 2021-03-21
    154 min

    [CAWD-198]Pale, Smooth Skin And Perky Nipples... This Young Teen Is Still Developing - Halfway Between A Girl And A Woman - Former C***d Star Hinano Aiuchi - Her One And Only Porn Debut

  • aiuchi hinano censoreduniformsingle workCAWDkawaiikannana dainanaCAWD-198CAWD198cawd00198
    • 2021-04-06
    101 min

    229SCUTE-1112 Ami (22) S-Cute Lolita wants to be stabbed in the back

  • amateur censoredbig titsuniformscutescute-1112scute1112229scute-1112
    • 2021-04-22
    119 min

    [FSDSS-211]Cuckholding Video Of Serious Wife Immediately Getting Seduced By A Huge Thick Cock Moe Amatsuka

  • angel moe censoredsingle workdramaFSDSSfalenomanyufaleno starFSDSS-211FSDSS2111fsdss00211
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-04
    140 min

    [SDAB-181]A Sensual Babe Who Experienced Extreme Pleasure During Her First Creampie Fuck "My Pussy Is Going Crazy!" Instant Insertion Into A Squirting Pussy! A Collaboration Of Squirting And Sperm! Ran Sakita

  • sakida run censoredcreampiesquirtingSDABsod createkaoruone s youthSDAB-181SDAB1811sdab00181
    • 2021-05-15
    125 min

    [MOPT-007]The Best Prostitute, Who Turns Masochistic Men Crazy By Bringing Them To The Edge Of Climax And Then Repeatedly Making THem Pull Out - Ameri Hoshi

  • star ameri censoredanalslutMOPTm o paradisemo tightMOPT-007MOPT007mopt00007
    • 2021-07-17
    62 min

    Pacopacomama 071721_504 Beautiful Mature Lady Bringing a Sex Stool Gives Perfect Pleasures Junko Kunida

  • amateur uncensoredpacopacomama
    • 2021-07-20
    186 min

    [SDNM-291]I Want To Repeatedly Experience The Wonderful Smile Of This Soothing Massage Parlor Therapist Yuhi Izumi 33 Years Old The Final Chapter She Was Unable To Suppress Her Desires, And Now She's Having Her First And Final Fuck With Another M

  • izumi freezing censoredcreampiebig titsSDNMsod createzaku araigenuine married woman the porn experienSDNM-291SDNM2911sdnm00291
    • 2021-07-22
    119 min

    [WAAA-085]The Tight Cowgirl Sex Is So Good She Comes Multiple Times True Loving Creampie Bathhouse Nanase Asahina

  • asahina nanase censoredcreampiesingle workWAAAwanz factorywanzWAAA-085WAAA085waaa00085
    • 2021-08-10
    57 min

    Caribbeancom 081021-001 3p Plan By Nominating Two Call Girls Who Are Gorgeous Yuna Sasaki, Reina Shiraishi

  • amateur uncensoredcreampielesbiancaribbeancom
    • 2021-08-21
    131 min

    [CEMD-049]Eye-Watering Non-Stop Hard Cum Fucking 13 Chisato Shoda

  • shota chisato censoredbig titsmature womanCEMDserebu no tomoCEMD-049CEMD049cemd00049
    • 2021-08-30
    45 min

    358WITH-103 Haruna (21) S-Cute With Bath Chopsticks Gonzo H

  • amateur censoredamateurbeautiful girlwithwith-103with103358with-103
    • 2021-09-02
    65 min

    FC2PPV 2129146 [Big Breasts Ero Bunny Jcup] Absolutely No Outflow! A Cosplay Orgy Party Inviting Two Idols To Their Home! Fully Seeding The Pussy That Is Hard To Estrus And Back Individual Shooting [Completely Ejaculated Female Meat Onaho]

  • amateur uncensoredfc2
    • 2021-09-10
    477 min

    [OFJE-328]Celebrity Riri Nanatsumori First-Time Best S1 Debut 1-Year Anniversary. Latest 11 Titles, 8-Hour Special

  • nanatsumori riri censoredbeautiful girlsingle workOFJEs1 no 1 styleOFJE-328OFJE328ofje00328
    • 2021-09-11
    170 min

    [MKMP-415]夜を使いはたして、朝陽が昇るまで渚みつきにひたすら犯●れ続けたい。

  • scooping censoredcreampieslutMKMPk m producesamoarimillionMKMP-415MKMP415mkmp00415
    • 2021-09-15
    125 min

    [GVH-294]Family Fun - Miyu Tsubakihara

  • miyu tsubakihara censoredcreampiemature womanGVHglory questtakahashi chitsujiGVH-294GVH294gvh00294
    • 2021-09-17
    68 min

    230OREC-879 Mai

  • amateur censoredcreampieamateurorecorec-879orec879230orec-879
    • 2021-09-23
    61 min

    H4610 ki210923 Yuka Sakura 26years old

  • amateur uncensoredh4610
    • 2021-10-08
    136 min

    [JUL-736]Day after Day of Creampie Orgies That Will Never End for All Eternity. Honoka Yonekura

  • hoika yonekura censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-736JUL736jul00736
    • 2021-10-14
    62 min

    336KNB-176 A Beautiful Wife Who Decides To Appear In An AV And Shakes A Ripe Erotic Body And Drowns In Sex With Other Than Her Husband. 69 At Miyahara Station, Saitama City, Saitama Prefecture

  • amateur censoredbig titsmarried womanknbknb-176knb176336knb-176
    • 2021-11-05
    207 min

    [HUNTB-136]"I"m Never Satisfied... So... Please..." Sex With Older Step-brother To Conceive Isn"t Satisfying At All, So This Super Hot Sister-in-Law Releases Her Pent-up Frustrations On Her Younger Step-brother For Creampie Fucking.

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-136HUNTB136huntb00136
    • 2021-11-06
    174 min

    [SUPA-598]First Time Shots For An S-class Super Bitch Amateur

  • censoredcreampieamateurSUPAs kyuu shiroutoSUPA-598SUPA598supa00598
    • 2021-11-11
    122 min

    [FSDSS-321]I Missed The Last Train, But My Coworker Agreed To Let Me Stay Over. The Sight Of Her Loungewear With No Underwear Was Too Much For This Virgin To Resist, And We Ended Up Fucking All Night Starring Nene Yoshitaka

  • nine yoshitaka censoredslutsingle workFSDSSfalenogr3faleno starFSDSS-321FSDSS3211fsdss00321



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored