high vision slender censored javcensored big tits




FC2DASDAVSAAUKGHNDAWDGVHVENXHZGDFSDSSDTTNATRSQTESTARSCAWDMIDEIPXABWATIDKSBJONEZ

2020-10-01
116 min

[AMBI-114]Perverted Stepdad's Sex Toy Beautiful S********l Has Her Relationship With Boyfriend Ended Urara Kanon

  • hanaoto urara censoredcreampieschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-114AMBI114h-237ambi00114
    • 2020-10-24
    116 min

    [CAWD-127]My Mean Slutty Junior's Handjob I Can't Resist It Even For 1 Minute - Moko Sakura

  • sakura moko censoredcreampiebeautiful girlCAWDkawaiiamazing meatCAWD-127CAWD127cawd00127
    • 2020-10-25
    123 min

    [OPKT-027]Forbidden Pregnancy OK: Creampie Part-time Job - Hikari Imai

  • hikari imai censoredcreampiesingle workOPKTtoyohikotoyohikotoyohiko kikakuOPKT-027OPKT027opkt00027
    • 2020-10-28
    42 min

    355OPCYN-116 Ema

  • amateur censoredcreampiemarried womanopcynopcyn-116opcyn116355opcyn-116
    • 2020-10-30
    133 min

    [IONV-001](Streaming Preview) Amateur Uploads A Perverted Office Lady's Self Squirting Sumire 22 Years Old

  • censoredcreampiesquirtingIONVion mousouzokuIONV-001IONV001ionv00001
    • 2020-11-06
    113 min

    [RBD-993]My Body Is Unable To Survive Unless I Have Sex With This Man A Plain Jane Office Lady Undergoes Perversion Training Kana Yume

  • kana yui censoredsingle workdramaRBDattackersnaotoryupakuRBD-993RBD993rbd00993
    • 2020-12-09
    73 min

    FC2PPV 1600556 [Personal shooting] Several months after the wedding … Newlywed wife who was vaginal cum shot full version

  • amateur uncensoredfc2
    • 2020-12-12
    182 min

    [MIFD-139]A Fresh Face 19 Years Old An H-Cup Big Tits College Girl In Glasses Makes Her Adult Video Debut - She Looks Like Her Guard Is Strong, With Her Glasses In Place, But Her Titties Are Unprotected - Nenne Ui

  • first love censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-139MIFD139mifd00139
    • 2020-12-21
    88 min

    [PPMNB-105]Youth/Study Balance!/Koharu Takigawa

  • censoredbig titsbeautiful girlPPMNBintec incPPMNB-105PPMNB105h-706ppmnb00105
    • 2020-12-27
    47 min

    FC2PPV 1622120 ★ First shot rare amateur ☆ Pitch Pichi ♥ H love! Beautiful girl JD Momo-chan 20 years old ☆ Pichirori BODY electric blame Iki ♥ Seriously! Geki Blow blame ♥ Zuppoli raw deep insertion and vaginal cum shot ♥ [Personal shooting] * With

  • amateur uncensoredfc2
    • 2021-01-15
    145 min

    [BANK-026]A Super Beautiful Nasty, Horny Elder Sister With H-cup Tits Who Cums Immediately In An Open-air Hot Spring

  • censoredcreampiebig titsBANKpussy banktake chanBANK-026BANK026h-1495bank00026
    • 2021-01-17
    81 min

    FC2PPV 1648847 I tried vaginal cum shot to my senior who works part-time.

  • amateur uncensoredfc2
    • 2021-01-22
    480 min

    [MBM-261]We Made Record-Breaking Sales On A Streaming Website! A Legendary Amateur Mature Woman In A Divine Video Infidelity Cum-Sucking Sex 36 Ladies 8-Hour Special

  • censoredcreampiemarried womanMBMprestigesasazuka garoumbmMBM-261MBM261118mbm00261
    • 2021-01-22
    57 min

    [oretd-840]AMASAWA

  • amateur censoredcreampieuniformoretdoretd-840oretd840oretd-840
    • 2021-01-24
    127 min

    [GENM-070]The Sequel: Breaking In A Trapped Babe At An Outdoor Warehouse Caught On Camera Rika Tsubaki

  • tsubaki rika censoredbig titssingle workGENMgenekig 3GENM-070GENM070genm00070
    • 2021-01-28
    62 min

    10musume 012821_01 The Wait is Over! I Got One of the Most Popular Escort Girl! YAMAKURAKIKO

  • amateur uncensored10musume
    • 2021-02-03
    77 min

    259LUXU-1371 Luxury TV 1361 A beautiful singer with beautiful big tits is here! If you insert a big cock into the vagina that has become thick with caress, you will accept it with a fascinating expression, and you will also expose your bewitching app

  • amateur censoredbig titsamateurluxuluxu-1371luxu1371259luxu-1371
    • 2021-02-18
    165 min

    [DVDMS-634]She's Got A Cute Face And A Bushy Pussy! This Perverted College Girl Loves To Get Cunnilingus When She Gets Her Deep Forest Of Pussy Hairs Licked, It Awakens Her Perversions ... And Then She'll Beg For Creampie Sex, Over And Over A

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-634DVDMS634dvdms00634
    • 2021-02-27
    165 min

    [JUFE-262]My Special Summer Break Together With Teacher... Beautiful Y********l in Uniform Having Her Sensitive Body And Beautiful Tits Dirtied By A Middle-Aged Man's Semen

  • satoshi kuruki censoredsquirtinguniformJUFEfitchJUFE-262JUFE262jufe00262
    • 2021-03-05
    93 min

    380SQB-091 Hikaru

  • amateur censoredcreampiebig titssqbsqb-091sqb091380sqb-091
    • 2021-03-06
    240 min

    [HUNTA-958]I Was The Nude Model At This Art Class, Full Of Young Wife Babes, And I Unexpectedly Got An Erection, And Now I Was In Big Trouble! Or Maybe This Was My Big Chance？ I Was Asked To Model For An Art Class And I Went And Found Out That All Of

  • censoredcreampieHUNTAhunterkoichi davidsonhhh groupHUNTA-958HUNTA958hunta00958
    • 2021-03-12
    88 min

    TNS-001 Sara

  • amateur censoredamateurtnstns-001tns001tns-001
    • 2021-03-18
    100 min

    [PRBYB-072]Pure White Sweet Lady/Mami Sakurai

  • censoredbig titsbeautiful girlPRBYBintec incPRBYB-072PRBYB072h-706prbyb00072
    • 2021-03-23
    62 min

    FC2PPV 1738461 ★ First shot amateur ☆ Libido vigorous ♥ Spo girl Chika who defeats as long as physical strength is 21 years old ☆ Love juice betchori electric blame Iki ♥ Exciting stakeout piston cowgirl ♥ Gonzo cum shot ejaculation ♥ [Personal shoot

  • amateur uncensoredfc2
    • 2021-03-25
    218 min

    [PIYO-110]Two Younger Stepsisters Dote On Their Older Stepbrother And Seduce Him With Their Tongues Slathered Over His Whole Body - He Can't Take It Anymore And They All End Up In A Raw Three-Some!

  • censoredcreampieschoolgirlPIYOhyokopiero dabicchiPIYO-110PIYO1101piyo00110
    • 2021-03-25
    120 min

    [ARSO-21144]My Wife -Celeb Club- 144

  • kaori ishihara ran koda censoredblowjobARSOaroundARSO-21144ARSO21144h-1378arso21144
    • 2021-04-11
    62 min

    SIRO-4463 [First shot] [Fair-skinned beautiful breasts] [Neat system her foolery] A neat system girlfriend who is dating a senior at the same university appears in AV while being nervous. She was caressed with pure white and fluffy beautiful breasts

  • amateur censoredamateursirosiro-4463siro4463siro-4463
    • 2021-05-14
    60 min

    FC2PPV 1811793 [No] It seems that she wanted to have sex with a sober and potato female college student, a 20-year-old whip whip body, and an uncle. [Individual shooting]

  • amateur uncensoredfc2
    • 2021-05-27
    49 min

    H4610 ki210527 Yukine Yamaguchi 25years old

  • amateur uncensoredh4610
    • 2021-06-04
    220 min

    [HUNTB-029]"You Can Do Whatever You Want To Me, But Please Leave My Brother Alone" "Fine, So Long As You Have Sex With Us For Three Days!" Loyal Little Stepsister Secretly Pays Her Stepbrother's Debts.

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-029HUNTB029huntb00029
    • 2021-06-04
    62 min

    520SSK-006 Saki

  • amateur censoredamateurbeautiful girlsskssk-006ssk006520ssk-006
    • 2021-06-07
    44 min

    FC2PPV 1857451 [Personal shooting, vaginal cum shot, W privilege, pt off for a limited time] Semen released in the vagina of the body that was tossed with a meat stick inserted for the first time in 5 years …

  • amateur uncensoredfc2
    • 2021-06-12
    146 min

    [CEMD-018]These Women Are Masochists! The Desperation Of 3 Lesbian Masochistic Women! Only The Biggest Masochists Understand The Extraordinary Pleasure That Awaits Beyond The Pain!

  • aya shiomi yuri sasahara censoredlesbianmature womanCEMDceleb no tomoCEMD-018CEMD018cemd00018
    • 2021-06-17
    111 min

    [VENX-048]Once A Month Sex Between A Step Mother And Her Step Son Who Moved To The City I'm On My Way To Be Fucked By My Step Son Again Hana Shirato

  • white peach censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-048VENX048venx00048
    • 2021-06-20
    240 min

    [NASH-528]Elegy For A Showa Wife - She Repays Her Husband's Loans With Her Body - Ravished By His Boss, His Lender, And Even A TV Reporter

  • censoredbig titsdramaNASHnadeshikocharlie miyazakiNASH-528NASH528nash00528
    • 2021-06-20
    125 min

    [DVMT-004]S*****t Goes Creampie Job-Hunting Sana

  • censoredcreampiebig titsDVMTtoyohikotoyohikotoyohiko kikakuDVMT-004DVMT004dvmt00004
    • 2021-08-12
    134 min

    [JRZE-068]First Time Filming My Affair. Rieko Masaki.

  • rieko masaki censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-068JRZE068h-086jrze00068
    • 2021-08-15
    67 min

    Pacopacomama 081521_518 Just Keep Fucking The Wife Who Wants To Get Pregnant Misato Wakaba

  • amateur uncensoredpacopacomama
    • 2021-08-31
    55 min

    292MY-484 Momose Miyabi 2

  • amateur censoredbig titsmarried womanmymy-484my484292my-484
    • 2021-09-09
    143 min

    [GUN-757]Vibrator Masturbation With Super Small Swimsuits 2

  • karen anba marina saito censoredsquirtingGUNradixsakuraba kyuu kokoro otokobatsugunGUN-757GUN757433gun00757
    • 2021-09-09
    74 min

    533NNS-004 Beautiful Girl Dies And Creampie Sexual Intercourse Out! !! Dirty Uniform! !! Sensitive Pussy With Masturbation Habit A Big Squirting Festival Where Beds, Clothes, Pussy And Dicks Are Soaked! !!

  • amateur censoredcreampieamateurnnsnns-004nns004533nns-004
    • 2021-09-17
    82 min

    FC2PPV 2212716 J-Cup-Chan And Kan * Re Kaohsiung ♪ In Bright Red Echii Underwear-Ecchi Edition- [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-10-02
    141 min

    [EVIS-374]Getting Rubbed By A Booted Slut"s Sweaty Feet And Dirty Talk

  • anne mashiro minami saya censoredlesbianEVISebisusan mousou zokucherry miyamaEVIS-374EVIS374evis00374
    • 2021-10-07
    49 min

    H0930 ki211007 Shinobu Amano 33years old

  • amateur uncensoredh0930
    • 2021-10-12
    48 min

    H4610 ki211012 Tomoyo Mizushima 26years old

  • amateur uncensoredh4610
    • 2021-10-15
    163 min

    [EBOD-865]Fwap Fwap Squeezed Between Colossal Tits!! Healthy Curvy Older Sister Gives Me An Energetic Titty Fuck

  • censoredbig titsEBODe bodykyouseiEBOD-865EBOD865ebod00865
    • 2021-10-22
    53 min

    FC2PPV 2301355 [Personal Shooting] 26 Years Old, A Large Amount Of Vaginal Cum Shot To A Dirty Young Wife With A Wet Big Pussy

  • amateur uncensoredfc2
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-01
    120 min

    [NACR-477]SEX Where Married Woman With Masochistic Tendencies Is Held Mayuka Kitagawa

  • mayuka kitagawa censoredbig titsbdsmNACRplanet plussakura ninshichi ku ryuuNACR-477NACR477h-237nacr00477
    • 2021-11-02
    63 min

    [HEYZO-2649]Asaka Sera Deep Kiss, Furious Sex -Entwined Tongues-

  • asaka sera uncensoredcreampiehandjobheyzo
    • 2021-11-03
    54 min

    230OREC-921 Reina (Reina Usami)

  • amateur censoredamateurcosplayorecorec-921orec921230orec-921
    • 2021-11-05
    88 min

    393OTIM-094 [Delusional Subjectivity] Is It Okay To Serve As A Child？ Ovulation Day Child Making Service Maid Nagisa Himawari

  • amateur censoredcreampieamateurotimotim-094otim094393otim-094
    • 2021-11-14
    76 min

    345SIMM-676 [One Night And Two Days Staying Date Trip With J ○ And Ejaculation] Icharab Comfort Trip To A Hot Spring Town With My Favorite Uncle Away From The City! !! One Vaginal Cum Shot In A Yukata That Looks Great On A Big Pie! !! Bringing A Unif

  • amateur censoredcreampiebig titssimmsimm-676simm676345simm-676
    • 2021-12-10
    57 min

    FC2PPV 2505826 ＃ 49 [No Individual Shooting] [Complete Appearance] 1000pt Off Until 12/14! ☆ A Healing Massage With A Raw Cock For A Beautiful Office Lady Who Is Tired From Work And Self-Restraint! Refresh Both Outside The Body And Inside The Vagina!

  • amateur uncensoredfc2
    • 2021-12-11
    121 min

    [MDS-898]Papa, Mama, And I Are Being Made To Feel Good By An Old Man Every Day In A Faraway Place. Yuzu Shirakawa

  • yuzu shirakawa censoredcreampiebeautiful girlMDSuchu kikakujohnny shibuyaMDS-898MDS898mds00898
    • 2022-01-07
    159 min

    [HUNBL-076]Demon Spanking The Big Ass Housekeeper

  • censoreddeepthroatHUNBLhuntergeminihhh groupHUNBL-076HUNBL076hunbl00076



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored