high vision squirting restraint censored




FC2MIDEAUKGCJODCAWDHZGDKSBJSQTEMIDVSPRDSANNACRMARADASDHDKANGODAWDMILKDASDNACXFSDSS

2020-12-26
153 min

[MIDE-863]I Love You. A Vague, Dangerous Memory Of Drowning In Sex With My Bestie's Boyfriend For 3 Days While She Was Away. [DVD Version] Nana Yagi

  • nana yagi censoredblowjobbeautiful girlMIDEmoodyzjo asagirimoodyz divaMIDE-863MIDE863mide00863
    • 2021-01-01
    240 min

    [MMB-342]Sweaty Wives: 7 Wives Overflowing With Sweat When They Shake Their Big Asses And Hips

  • maria nagai kina shinozaki censoredcreampiebig titsMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-342MMB342mmb00342
    • 2021-01-13
    32 min

    FC2PPV 1643479 Complete beauty re-advent! As usual, transcendental cute girlfriend and vaginal cum shot sex ♥ At the end it was too comfortable and I got out … (* noωno) * High quality version & review benefits included ♪ [Personal shooting

  • amateur uncensoredfc2
    • 2021-01-15
    120 min

    [REAL-756]All I Could Do Was Watch As My Girlfriend Got Fucked By My Own Father And Gradually Became His. Nana Maeno

  • nana maeno censoredschoolgirlsingle workREALreal worksjohnny shibuyareal real worksREAL-756REAL756172real00756
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    51 min

    FC2PPV 1647696 [Individual shooting] Connected to the dangerous back dirt J system famous for SNS and immediately squirrel halo ・ I can not stand it with more erotic pussy than rumors

  • amateur uncensoredfc2
    • 2021-01-21
    123 min

    [AKDL-077](An Adult Video We'd Like For You To Watch Before Going To Sleep) Totally POV A Pull Out Handjob To Help Guide You To A Pleasant Night's Sleep

  • yuka saeki i m in sakino censoredbig titsslutAKDLaquinorishrikenaknrAKDL-077AKDL0771akdl00077
    • 2021-01-29
    43 min

    490FAN-090 Akari

  • amateur censoredbig titsamateurfanfan-090fan090490fan-090
    • 2021-01-30
    40 min

    H0930 ki210131 Misa Ishida 32years old

  • amateur uncensoredh0930
    • 2021-02-06
    119 min

    [JUL-466]Swimming School NTR - A Married Woman Drowning In Her Instructor's Pleasantness - Yu Shinoda

  • shinoda yu censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-466JUL466jul00466
    • 2021-02-11
    113 min

    [XMOM-028]Enchanting Semen Wife - Continuous Fuck With A Beautiful Wife Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiemarried womanXMOMcenter villagesky cloudspink breathXMOM-028XMOM028h-086xmom00028
    • 2021-02-15
    55 min

    FC2PPV 1687665 [No] [Limited to 100 pieces 1000pt OFF!] Anyway, the blowjob is erotic! ♥ ️ De М professed smile beauty Gonzo ♥ ️ A large amount of vaginal cum shot in a tight pussy! !! ♥ ️ * Review benefits / Masturbation while watching mobile erotic

  • amateur uncensoredfc2
    • 2021-02-19
    12 min

    FC2PPV 1693328 Rio Yukopi Tech I had him pull out with a camera while I was playing

  • amateur uncensoredfc2
    • 2021-02-27
    46 min

    C0930 hitozuma1349 Itsumi Takekura 27years old

  • amateur uncensoredc0930
    • 2021-03-05
    189 min

    [DOCP-278]I Went To A Titty Pub That Didn't Allow Fucking, But The Girl Mounted Me During Dance Time And Started Rubbing Her Pussy Against My Crotch, And I Unexpectedly Got An Erection And Then My Cock Just Slipped Into Her Pussy, So Now, Will I

  • kawamura haru miho aikawa censoredbig titssquirtingDOCPprestigedocDOCP-278DOCP278118docp00278
    • 2021-03-12
    48 min

    FC2PPV 1723477 [Sale for a limited time] I don’t wear Udonge-chan! 2 shots to a horny rabbit Irama & vaginal cum shot & ass bukkake! It’s a rabbit that can be used a lot!

  • amateur uncensoredfc2
    • 2021-03-22
    169 min

    [MADV-506]A College Girl From A Prestigious Institution Is Working A POV Part-Time Job Her First Consecutive Creampie Fuck Fest

  • mitsu hirose mochizuki censoredbig titssquirtingMADVcrystal eizomaniac crystalMADV-506MADV506madv00506
    • 2021-04-09
    150 min

    [MIAA-421]Brothels Feel 100 Times Better! You Won't Be Able To Resist This Gal's Dirty Talk - Her Beautiful Booty Will Drive You Wid - Massage Parlor Slut Riho Fujimori

  • riho fujimori censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-421MIAA421miaa00421
    • 2021-04-12
    121 min

    [HONB-211](Momo) Flat Chested Girl With An Anime Voice (Saki) Super Rare Gal

  • censoredbig titsbukkakeHONBmercurythe first shibuya special f e headquarHONB-211HONB211h-1133honb00211
    • 2021-04-14
    160 min

    [BLK-494]She'll Drain Your Spank Bank Dry! Raw Fucks With A Pouty Slut! Her Wild, Incredible Body Will Send You Straight To Creampie Heaven

  • censoredcreampieblowjobBLKkira kirakira kira black galBLK-494BLK494blk00494
    • 2021-04-17
    117 min

    [NNPJ-441]Half-Japanese, Half-Brazilian Hottie Working At A Brazilian Wax Parlor - When She Sees A Cock, She Wants It Inside Her - Her Porn Debut Naomi Luiza Yamashita

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-441NNPJ441nnpj00441
    • 2021-04-17
    116 min

    [NNPJ-443]I Offered The Bold Babe Who Was Giving Me A Business Trip Massage A Huge Tip And To My Surprise She Was Down To Fuck For It Sarina

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-443NNPJ443nnpj00443
    • 2021-04-18
    77 min

    300MAAN-645 [Lady’s liberal arts JD / Deep Throating / Saddle tide ecstasy] Contrary to its neat and pretty appearance, I love erotic delusions while reading sensual novels! A sullenly sensitive girl who immediately gets her wet! !! Even more pa

  • amateur censoredcreampiesquirtingmaanmaan-645maan645300maan-645
    • 2021-05-01
    120 min

    [PRED-309]Her Ass Is Susceptible To Suggestion. I Lost My Mind Over That Beautiful Ass Belonging To The Girl Next Door, And I Kept On Pumping Her With Piston-Pounding, Out-Of-Control Creampie Sex ... Kano Kashii

  • kashii hanano censoredcreampiesingle workPREDpremiumeightelegancePRED-309PRED309pred00309
    • 2021-05-21
    71 min

    494SIKA-082 AV Bytes In Front Of My Parents For Money

  • amateur censoredcreampieschoolgirlsikasika-082sika082494sika-082
    • 2021-05-28
    31 min

    359TYVM-160 Cheating Sex In Work Uniform! ？？ Mass seeding of a horny wife working at a department store! !!

  • amateur censoredcreampiemarried womantyvmtyvm-160tyvm160359tyvm-160
    • 2021-05-28
    49 min

    328HMDN-366 Dero Married Woman With A Child Who Flocks On SNS 31 Years Old Erotic Buzzing Mature Milk H Cup Rubbing New Toy Saddle "Gimojiii" Raging Big Cock Portio Thrust Cum Shot Completely Fallen

  • amateur censoredcreampiebig titshmdnhmdn-366hmdn366328hmdn-366
    • 2021-06-11
    119 min

    [MIAA-455]My Cousin From The Country Is So Bored - Teasing Nipples With Her H-Cup Colossal Tits! She'll Get You Harder Than You've Ever Been In Your Life! Rui Miura

  • rui miura censoredbig titsslutMIAAmoodyzeveryone s porn starMIAA-455MIAA455miaa00455
    • 2021-06-17
    74 min

    [REBD-564]Yuria M - Magnificent - Yuria Yoshine

  • yoshine yuria censoredsingle workREBDrebeccaherpes takaREBD-564REBD564h-346rebd00564
    • 2021-07-10
    236 min

    [XRLE-009]Creampie Down Her Throat and in Her Pussy. An Obedient Face-Fuck. Riku Aisawa.

  • riku aizawa censoredblowjobdeepthroatXRLEreal worksani nakamurareal real worksXRLE-009XRLE009xrle00009
    • 2021-07-12
    33 min

    FC2PPV 1917707 [4k] Complete Amateur Individual Shooting Super Loli Girl College Student Arika-chan 20 Years Old Part5 Uniform Cosplay 2

  • amateur uncensoredfc2
    • 2021-08-06
    56 min

    H4610 ki210810 Misaki Makino 25years Old

  • amateur uncensoredh4610
    • 2021-08-06
    125 min

    [DASD-900]My Wife Will Come Home Soon. Akari Mitani

  • mitani akari censoredcreampiesingle workDASDdasasagiri jouDASD-900DASD900dasd00900
    • 2021-08-10
    44 min

    FC2PPV 1981146 [Hinomaru’S Midyear Gift 500p] I Couldn’T Forget The Magnum Cock And Remembered It Every Day And Masturbated. Gachinko Sex Of A Triple Three Upper Ball Girl With Beautiful Skin And Beautiful Breasts Spree On The Long-Sought M

  • amateur uncensoredfc2
    • 2021-08-12
    147 min

    [HBAD-591]Newlywed Bride From The City Takes It All In Deep At Husband"s Rural Country Home. Kanna Hirai

  • shiori hirai censoredblowjobsingle workHBADhibinoumanami jirobabeHBAD-591HBAD5911hbad00591
    • 2021-08-13
    477 min

    [OFJE-327]A Sleazebag Scene Of The Adultery Of An Extraordinarily Beautiful Married Woman: 50 Consecutive Shots And 8 Hours Of Pleasurable And Unfaithful French Kisses And Sex With Other Guys

  • saki okuda nami hoshino censoredbig titsOFJEs1 no 1 styleOFJE-327OFJE327ofje00327
    • 2021-08-20
    156 min

    [HMN-035]The Afterschool Nipple Play Creampie Harem Club, Starring Ichika Matsumoto and Hana Shirato

  • ichika matsumoto white peach censoredcreampiebeautiful girlHMNhonnakazampaHMN-035HMN035hmn00035
    • 2021-08-22
    88 min

    FC2PPV 2062581 New Sale Until 9/4! (No) [Powerful Subjective Menes 5 @ Kimono Beauty] Handjob Ejaculation / Shooting Outflow / A Veteran Instructor Who Appears In A Healthy Shop That Should Never Ejaculate ♡ Submerged In A Bewitching Adult Whole Body

  • amateur uncensoredfc2
    • 2021-09-10
    155 min

    [BBAN-341]This Big Tits Private Tutor Received Breaking In Training From A Doting Mama - An Instructional Lesbian Series Of Love, Slathered In Slobbering Drool - Waka Misono Hazuki Wakamiya Hikaru Minazuki

  • misono waka wakamiya censoredbig titssquirtingBBANbibianBBAN-341BBAN341bban00341
    • 2021-09-18
    80 min

    FC2PPV 2216118 A Teenage Active Student, A Miracle Beautiful Girl Shiho-Chan. She Is Loved By Enthusiastic Fans And Has A Large Amount Of Vaginal Cum Shot And A Large Amount Of Facial Cum Shot On Her First Semen Cum Swallowing.

  • amateur uncensoredfc2
    • 2021-09-25
    240 min

    [HUSR-243]All Blonde! And They"re All Hotties With Crazy Measurements! Most Amazing Raw Fucking With East Europe SSS Rank Hotties! 10 Women 4 Hours

  • candy tee vibiana censoredbig titsamateurHUSRbig mocalbooker thustleHUSR-243HUSR24357husr00243
    • 2021-10-23
    240 min

    [ENKI-042]Slut With Colossal Tits Gets Taken For Intense Training To Bring Out Her Masochistic Ways. A Group Of Perverts Meet Up With Her In A Public Bathroom For Filthy Fun And Creampie Loads.

  • censoredcreampieENKIpoisonous banquetENKI-042ENKI042enki00042
    • 2021-10-25
    59 min

    541AKYB-038 Megu (24) Pursuit Blow From Creampie To National Treasure Class G Breast Girl (Megu Mizumori)

  • amateur censoredcreampiebig titsakybakyb-038akyb038541akyb-038
    • 2021-10-29
    146 min

    [CAWD-306]A Sexual Genius Barely Legal Babe Cums With Thunderous, Vulgar Pleasure! She Keeps On Cumming So Hard, I"m Just Hooked On Her Body ... Rion Kanami

  • rion kanami censoredsquirtingsingle workCAWDkawaiitake dCAWD-306CAWD306cawd00306
    • 2021-11-01
    125 min

    [AMBI-142]My Secret Lovey-dovey Married Life With My Teacher Yui Tenma

  • yui tenma censoredcreampiebeautiful girlAMBIplanet plusdirector oanbibarentsuAMBI-142AMBI142h-237ambi00142
    • 2021-11-04
    49 min

    H0930 ki211104 Taeko Kashitani 28years old

  • amateur uncensoredh0930
    • 2021-11-16
    121 min

    [KTRA-347]Creampie Into My Daughter-In-Law"s Shaved Pussy Rio Nakamura

  • rio nakamura censoredcreampieschoolgirlKTRAke toraibuk tribeKTRA-347KTRA347h-094ktra00347
    • 2021-11-17
    59 min

    FC2PPV 2440827 New Work [Beautiful Business Owner’S Reproductive Behavior In The Afternoon] Limited Number 4980 → 2980 ・ I Can’t Stand The Fact That I’m Telling Employees To Work … Can You Squeeze With A Hard Meat Stick？ There Is

  • amateur uncensoredfc2
    • 2021-11-19
    118 min

    [SSIS-251]City Girl Bored Out In The County"s Got Nothing To Do But Seduce Older Men Uta Hayano

  • hayano uta censoredbig titsbeautiful girlSSISs1 no 1 stylekitorune kawaguchiSSIS-251SSIS251ssis00251
    • 2021-11-19
    58 min

    FC2PPV 2446706 [Uncensored] A Clitoris That Is Stripped Of Slurp That I Want 100 Million People To See. Her Awakening-Clitoris 2 Standing Nio Akemi Saito (23 Years Old)

  • amateur uncensoredfc2
    • 2021-11-20
    125 min

    [AGAV-067]The Most Beautiful Girl - A Fetishistic Masturbation Recipe Provider Who Will Take Care Of Any Request - Yuzu Shirakawa

  • yuzu shirakawa censoredbeautiful girlslutAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-067AGAV067agav00067
    • 2021-12-07
    50 min

    FC2PPV 2496541 [No] Sister-Based Beautiful Girl Miku-Chan And Icharab Gonzo ♡ Intense Blowjob That Sucks Ojisan Semen With A Pure Innocent Face ♥ Ignore "Get Out ♡" And Legally Vaginal Cum Shot!

  • amateur uncensoredfc2
    • 2021-12-10
    20 min

    10musume 121021_01 A Cute Face Chick Licks My Cock Like An Ice Cream Keiko Udaka

  • amateur uncensored10musume
    • 2021-12-11
    158 min

    [SCOP-748]Popular Sex Techniques Bring So Much Pleasure That It"s Hard To Take Till Morning! No.1 Masochistic Call Girl With Superior Techniques Works At A Room In My Apartment Building, And She Happens To Be The Elegant Married Woman I See In Th

  • censoredsluthandjobSCOPscoopjohnny shibuyamousouzokuSCOP-748SCOP748scop00748
    • 2021-12-24
    138 min

    [CJOD-327]"We"re Going To Cum Over And Give Your C*ck The Slut Treatment, Okay？" These Two Sweat And Sadistic Beautiful Girl Babes Gave Me Such A Cum Swallowing, Creampie Fucking, Man-Squirting Good Time, My C*ck Was Totally Busted Ichika

  • ichika matsumoto yui nagase censoredcreampiebeautiful girlCJODchijo heavensamoariCJOD-327CJOD327cjod00327
    • 2022-01-01
    55 min

    Pacopacomama 010122_582 Happy New Year Orgy Reiko MizuharaHiromi Okura

  • amateur uncensoredpacopacomama



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored