high vision uniform jav blowjob censored




FC2VENUADNBLKABWAVSAONEZSQTEGMEMWAAAPPPDMILKHDKAGVHFSDSSLULUMEYDAUKGHZGDNNPJSSIS

2020-09-13
122 min

[USAG-019]A Girl With A Sensual Pussy I'm Filming Myself Having Lovey-Dovey Sex And Dick-Pumping Creampie Sex With This Super Cheerful And Friendly Beautiful Girl College Girl Who Is Proud Of Her Beautiful Ass

  • censoredcreampieUSAGrabbit daydreamersUSAG-019USAG019usag00019
    • 2020-09-15
    46 min

    H0930 ki200915 Maki Shimamoto 36years old

  • amateur uncensoredh0930
    • 2020-09-24
    150 min

    [MOND-199]An Older Brother Who Comes Onto His Younger Brother's Wife - Yuri Tadokoro

  • yuri tadokoro censoredmature womansingle workMONDtakara eizoumimasaka shundaiichi housouMOND-199MOND19918mond00199
    • 2020-09-24
    413 min

    [NHDTB-442]Out Here, In The Open Air!？ A Sudden Smile That Doesn't Stop Even After The Facial These College Girls Ask For It A Second Time #6! 30 Girls In Total, 60 Shots, Luxury Version With Highlights

  • censoredblowjobNHDTBnatural highxylo onokine raftin maeshiroNHDTB-442NHDTB4421nhdtb00442
    • 2020-09-25
    239 min

    [YSAD-043]Married Woman Sex Toy Fucked And Pleasured

  • yuka sawahara naoko akase censoredcreampiebig titsYSADkomyoYSAD-043YSAD043540ysad00043
    • 2020-09-25
    145 min

    [BANK-015]Meet A Normal-Looking, Adorable Housewife Who Looks Like The Kind Of Lady Who Lives In The Neighborhood Of The Creampie Outdoor Hot Spring Resort! She Looks Like A Plain Jane, But This Beautiful And Innocent Lady With A Slender Body Has Hug

  • censoredcreampieBANKpussy banktake chanBANK-015BANK015h-1495bank00015
    • 2020-09-26
    166 min

    [WANZ-986]These Mounds Are Just The Right Size - Enjoy Every Part Of These 33" D-Cup Boobs - Tsubomi - Her First Experiences At A Titty Bar

  • bud censoredcreampieblowjobWANZwanz factorywanzWANZ-986WANZ986wanz00986
    • 2020-10-10
    157 min

    [DASD-742]Breaking In My Stepsister In Bed - 100 Days Of Memories Caught On Camera Eimi Fukada

  • emi fukada censoredsingle workdramaDASDdashiromichi hoseDASD-742DASD742dasd00742
    • 2020-10-12
    22 min

    FC2PPV 1532091 ≪Appearance≫ Nasty! Neat and slender beauty ❤ Masturbation by fingering the pussy that became slimy with lotion ♪ Please try to see that the lewd juice overflows to the anal that does not stop hikuhiku w (Full HD main part review privi

  • amateur uncensoredfc2
    • 2020-10-21
    32 min

    330PER-326 Runa

  • amateur censoredamateurperper-326per326330per-326
    • 2020-10-25
    122 min

    [MGMQ-059]A 170cm Tall Slut Teacher's Forbidden Sex Education For A Masochistic Man - Kanon Nakajo

  • nakajo canon censoredanalslutMGMQmegamibijo shin queenMGMQ-059MGMQ059mgmq00059
    • 2020-11-18
    92 min

    300MIUM-653 [Bali Carry G Cup] Dissipate the stress of a woman who works fiercely with sex! The whole story of the manager of the cafe store, who is about to open a new store, interrupts the busy schedule and inserts it.

  • amateur censoredbig titssquirtingmiummium-653mium653300mium-653
    • 2020-11-27
    240 min

    [XRW-946]20 Loads In a Row Creampie: Female S*****ts Ultimate Beautiful Girls Wearing Uniforms - 20 People, 4 Hours Pregnancy Special

  • toua kotone scooping censoredcreampieuniformXRWreal workshyena old manreal real worksXRW-946XRW946172xrw00946
    • 2020-11-27
    100 min

    FC2PPV 1585314 [No / Amateur individual shooting] A new frontier that fulfills your wishes! Pocha Big Sisters 4P Orgy W Creampie! Collusion with my sister who loves her sister and wants to see her sex! To the new world of unraveling meat that is swep

  • amateur uncensoredfc2
    • 2020-11-29
    128 min

    [KTKL-090]A Lolita Dick-Sucking Little Devil Slut Hinako "I Get Excited When I Put Men In Embarrassing Situations"

  • censoredcreampieslutKTKLkitixx mousouzokuloliconKTKL-090KTKL090ktkl00090
    • 2020-12-02

    FC2PPV 1592219 Limited [No] Supporting the egg of a voice actor who came to Tokyo for a dream, continuous vaginal cum shot (47 minutes)

  • amateur uncensoredfc2
    • 2020-12-04
    31 min

    FC2PPV 1593596 Combo of transcendental mafera in bondage ♥ Nipple and anal torture handjob! Raw SEX finish ♥ [Review benefits available]

  • amateur uncensoredfc2
    • 2020-12-06
    124 min

    [SOAN-052]Her Ass Is The Pride Of The Nation: Outstanding Youth Athlete Going For The 3000m Record Dreams Of Having Anal Sex While Wearing Her Uniform

  • censoredSOANyama to soramaketaro tanizokoanal visitSOAN-052SOAN052soan00052
    • 2020-12-12
    150 min

    [DASD-775]Breaking In An Obedient Transsexual At Work. Riara Yumemi

  • dream dream censoredanalsingle workDASDdasrokusaburo mishimaDASD-775DASD775dasd00775
    • 2020-12-24
    163 min

    [MILK-099]Whole-Body Sensitive Sensor - She Seems Prim And Proper But When She's In Front Of The Camera She Loves To Fuck Kurumi Ito

  • kurumi ito censoredblowjobbeautiful girlMILKmilkMILK-099MILK099h-1240milk00099
    • 2021-01-01
    120 min

    [ONEZ-269]Obedient Sugar Baby Yukino Nagasawa vol. 002

  • yukino nagasawa censoredcreampiebig titsONEZprestigetodoonezONEZ-269ONEZ269118onez00269
    • 2021-01-21
    60 min

    FC2PPV 1652972 [Complete amateur 98] Hitomi 19 years old, complete appearance, vaginal cum shot & mouth shot to a plump fair-skinned beautiful girl

  • amateur uncensoredfc2
    • 2021-01-21
    124 min

    [FSDSS-159]U-IJIN 01 - Fresh Face: Meisa Kawakita

  • kawakita meisa censoredbeautiful girlsingle workFSDSSfalenoboomer 44faleno starFSDSS-159FSDSS1591fsdss00159
    • 2021-02-12
    30 min

    417SRYA-011 I was targeted by a hungry female crocodile! !! There is a woman’s predecessor in the open-air bath … The cock begins to react to the naked woman’s body and shows me awkward masturbation! The semen tank is empty due to the

  • amateur censoredcreampieamateursryasrya-011srya011417srya-011
    • 2021-02-15
    108 min

    300MIUM-679 A trip to Atami with a petite F-cup beautiful girl! The true identity of a beautiful girl who seems to be happy is a carnivorous romance strong man! A waruii woman who is proud of her short stature, big breasts, and peach butt! !! With a

  • amateur censoredcreampiebig titsmiummium-679mium679300mium-679
    • 2021-02-18
    69 min

    200GANA-2439 In the spear room of the Nampa teacher of 100 battles, a girl who brought in SEX secret shooting 190 asked if she would be an instructor instead because it would cost more to go to the gym. She gradually escalated to the good thing that

  • amateur censoredbig titsamateurganagana-2439gana2439200gana-2439
    • 2021-03-06
    102 min

    FC2PPV 1713624 [No individual shooting, absolutely Eloy guy who can understand by looking! The third dark route beautiful girl! ] Flood w Blow & Tsuruman repeatedly with splash squirting until withered M seeding SEX with a beautiful girl and love

  • amateur uncensoredfc2
    • 2021-03-09
    62 min

    C0930 ki210309 Mika Aoto 33years old

  • amateur uncensoredc0930
    • 2021-03-14
    78 min

    FC2PPV 1726357 [Actual record] I taught the strictness of adults to P-active girls who are dull and naive.

  • amateur uncensoredfc2
    • 2021-03-27
    120 min

    [KSBJ-127]Spartan Sex Education From Intellectual Stepmoms Satomi Suzuki

  • satomi suzuki censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-127KSBJ127ksbj00127
    • 2021-04-03
    126 min

    [ANCI-040]GOLDEN BALL Z Android 18 Sex Battle!

  • censoredcosplayANCIspartan mousouzokuryu karasuyamaspartanANCI-040ANCI040anci00040
    • 2021-04-24
    158 min

    [LULU-067]My Adorable Girlfriend's Terrifying Stepdad Was Out For The Day, I Spent The Whole Time Nailing Her From Dawn To Dusk - French Kisses And Creampies Wan Horikita

  • horikita wan censoredcreampieschoolgirlLULUlunaticsluminaxLULU-067LULU067lulu00067
    • 2021-04-29
    125 min

    [JRZE-044]Entering The Biz at 50! Naomi Arimori

  • naomi arimori censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-044JRZE044h-086jrze00044
    • 2021-05-02
    242 min

    [MMB-364]Shinbashi Sluts - 10 Sugar Babies Seeking Dates - Already Bored Of Their New Jobs, They Want A Little Excitement Over Their Vacations! Special - Me, Their Boss, Will Show You How To Score With Them

  • censoredamateurbeautiful girlMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-364MMB364mmb00364
    • 2021-05-17
    88 min

    FC2PPV 1809270 [Individual] G cup beautiful wife 35 years old, Gonzo sex that is covered with oil at the hotel and is squid by a young man who is one or more lower [First special price]

  • amateur uncensoredfc2
    • 2021-05-23
    42 min

    413INST-124 [Drive Nampa 2]! 3 to 3 Ero Bitch Manko ♀ VS Nampa Gonzo Corps! Orgy Raw Saddle Cum Inside Party From Home Drinking Penis Fishing Libido Girls Hikari

  • amateur censoredcreampieamateurinstinst-124inst124413inst-124
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-29
    198 min

    496SKIV-008 Atsuko-chan 2 (22)

  • amateur censoredamateurskivskiv-008skiv008496skiv-008
    • 2021-07-03
    151 min

    [URKK-041]Live-In Lifestyle With My I-Cup Step-Cousins: The Temptation Of Their Colossal Tits - Titty Fucks, Dual Creampie

  • tomoko kamisaka yukino nagi censoredbig titssisterURKKunfinishedrolanda familiar breastURKK-041URKK041urkk00041
    • 2021-07-15
    112 min

    [DDOB-095]Brainwashing so that I Can Come in Her Pussy. Jun Haruaki.

  • jun shunmei censoredcreampiemature womanDDOBdogmatenunmy auntDDOB-095DDOB095ddob00095
    • 2021-07-30
    40 min

    359TYVM-177 Incest I Dreamed Of … The Year’S Different Seeding Sex That Fulfills The Desire Of A Fifty Wife That My Son Wanted!

  • amateur censoredcreampiemarried womantyvmtyvm-177tyvm177359tyvm-177
    • 2021-08-06
    300 min

    [MUCD-250]Shooting Semen Into Her Cute Face! 20 Beautiful Girls End With Cum On Their Faces. 300 Minutes!

  • haruka suzumiya yuri fukada censoredblowjobbeautiful girlMUCDinnocentMUCD-250MUCD250mucd00250
    • 2021-08-10
    90 min

    484SDGN-016 God Body Shop Clerk I Like Raw! I Like Eroticism! I Have Made A Vaginal Cum Shot On A Pie Bread That Has Accumulated Sexual Desire After Drinking Alcohol!

  • amateur censoredcreampieamateursdgnsdgn-016sdgn016484sdgn-016
    • 2021-08-12
    224 min

    [SUN-023]First Exhibition And First Adultery After Marriage. Immoral Creampie Two Day Trip

  • aimi rui akikawa censoredbig titssingle workSUNsuntanaka baconSUN-023SUN02313sun00023
    • 2021-08-13
    31 min

    520SSK-020 [First Thing Chi ● Landing Po With Love Max] [Virgin’S Sweet Brush Down] [Cosplay Finest Beautiful Girl] [Gently Lead Me ● First Thing Ochi ● Invite Po ♪] [Virgin Sperm Raw Creampie] "Hikaru-Chan"

  • amateur censoredcreampieamateursskssk-020ssk020520ssk-020
    • 2021-08-14
    163 min

    [MMYM-047]Endless Fuck Monster With A Slutty Face, Dirty Talk Woman, Ayaka Mochizuki

  • ayaka mochizuki censoredslutsingle workMMYMmarrionyumeno aidayumenoMMYM-047MMYM047mmym00047
    • 2021-08-31
    183 min

    [SDNM-299]People Think I Can Do Anything But There Are Times Where I Just Want To Be Spoiled Airi Suenaga, 29, AV DEBUT

  • suenaga airi censoredmarried womansoloworkSDNMsod createcompany matsmahonmono hitodzuma dannani naisho de av taikenSDNM-299SDNM299
    • 2021-09-03
    141 min

    [HODV-21607](All POV) Rural Girls With Accents: Shizuoka Dialect Rin Kagura

  • kagura rin censoredcreampiesingle workHODVh m pHODV-21607HODV216075642hodv21607
    • 2021-09-18
    114 min

    [USAG-036]A Girl Who Likes To Serve And Is An Advocate Of Pleasure Momoka-chan (19 Years Old) A Nursery School Teacher / A Big Ass / A Beautiful Girl / Shaved Pussy / Creampie / Cum Face / Threesome

  • censoredbig titsamateurUSAGusagi mousozokuUSAG-036USAG036usag00036
    • 2021-09-22
    69 min

    355OPCYN-177 Rua 2

  • amateur censoredcreampiesquirtingopcynopcyn-177opcyn177355opcyn-177
    • 2021-09-23
    195 min

    [ABW-148]アオハル 制服美少女と完全主観で過ごす性春3SEX。 ＃08 エッチで甘酸っぱい青春グラフィティを全てあなた視点で体験する180分 七嶋舞【MGSだけのおまけ映像付き 15分】

  • amateur censoreduniformamateurabwabw-148abw148abw-148
    • 2021-09-24
    81 min

    FC2PPV 2245126 [4980 → Limited Number Of 3980] Complete Appearance ❤️ Too Lascivious Beauty Nursery Teacher ❤️ Nipples And Pussy Are Alive And Absentminded ❤️ Flowering To A De M Girl With Deep Throating ❤️ Drowning In Pleasure And Vaginal Fertilizat

  • amateur uncensoredfc2
    • 2021-09-24
    240 min

    [REXD-385]That Woman... She Made Such A Fool Of Me... I Want To Take Revenge... For What She Did To Me...

  • censoredcreampieREXDredgroupREXD-385REXD385rexd00385
    • 2021-10-02
    103 min

    [SQTE-383]Lost In Sena"s Body: You"ll Be Unable To Stop Yourself From Masturbating With Her G-Cups And Fetishes On Full Display! Starring Sena Kasumi

  • sena kasumi censoredbig titssquirtingSQTEs cutes cute s cuteSQTE-383SQTE383sqte00383
    • 2021-10-15
    150 min

    [BLK-532]She"ll Eat Men Up As She Bares Her Super Carnivorous Sexual Instinct To Prey On Cocks! Let"s Cum With Queen Maria! An Orgasmic Banging Date Maria Nagai

  • maria nagai censoredcreampiebig titsBLKkira kiratorendei yamaguchikira hosi kira black galBLK-532BLK532blk00532
    • 2021-10-25
    82 min

    [THNIB-081]love bite/Yuna Ito

  • censoredbig titsbeautiful girlTHNIBcraneTHNIB-081THNIB081h-706thnib00081



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored