hoshino natsuki




FC2RBDBLKAMBINACXJULWAAAMILKFSDSSGVHSQTEMARACESDAUKGNGODAPODNNPJHUNTBKBIMIAABBAN

2020-10-24
162 min

240TOKYO-402 Natsuki

  • amateur censoredcreampieamateurtokyotokyo-402tokyo402240tokyo-402
    • 2020-11-27
    125 min

    [KNMB-007]Hinako Takes It Raw #Tall Office Babe With Beautiful Legs #Real Estate Agent #She Wants It Bareback #No Condoms Allowed #The Pantyhose Stays On Hinako Mori

  • hinako mori censoredcreampiesingle workKNMBfirst star100 raw styleKNMB-007KNMB007h-491knmb00007
    • 2020-12-01
    187 min

    [CHA-020]Nip Slips And Panty Shots... Is She Tempting Me!？ T, There's No Way I Can Resist This Shit!

  • censoredamateurCHAlahaina tokaichaosCHA-020CHA020h-189cha00020
    • 2020-12-05
    114 min

    [ADN-279]Dirty Licker Desires Of A Father-In-Law 6 Minori Hatsune

  • hatsune minori censoredbig titssingle workADNattackersnaotootona no dramaADN-279ADN279adn00279
    • 2020-12-05
    75 min

    300MAAN-607 [Halloween 2020, Bewitching Half-Demon Woman] A user of the etch technique that suddenly appeared in the halloween of Shibuya. The appearance of removing the sealed bamboo from the mouth and devouring people with desire is just a devil! E

  • amateur censoredcreampiebig titsmaanmaan-607maan607300maan-607
    • 2020-12-12
    112 min

    390JAC-075 [G huge breasts cheer girl x 5 vaginal cum shot] Pai slash! !! Big breasts RUSH on the verge of explosion! G huge breasts that shake swaying Japan! Good to touch! Good to see! It’s okay to massage! Don’t miss the strongest rampag

  • amateur censoredcreampiebig titsjacjac-075jac075390jac-075
    • 2020-12-24
    27 min

    FC2PPV 1618176 [Prevention of body baldness, Gonzo] Creampie at home after having a meal date with a beautiful older sister’s saffle

  • amateur uncensoredfc2
    • 2020-12-25
    243 min

    [OPSS-003]Amateur POV Busty Teacher 3

  • censoreduniformamateurOPSStmatitty teacherOPSS-003OPSS00355opss00003
    • 2021-01-15
    180 min

    [DIPO-088]Top Secret Leaked Footage! Middle-Aged Guy Filmed His Affair With A Married Slut

  • censoredDIPOprimoero nandesuDIPO-088DIPO088h-283dipo00088
    • 2021-01-29
    125 min

    [BANK-028]The Greatest Erotic And Cute Gal, With A Tight Waist! She's So Fucking Cute And She Cums With Spasmic Intensity A Slender Gal Itsuki Hasegawa

  • hasegawa ju censoredsingle workBANKpussy banktake chanBANK-028BANK028h-1495bank00028
    • 2021-02-21
    72 min

    300NTK-523 Sober female character sudden change! !! H cup Echi Echi GAL! !! Cleavage pushing costumes and sexual desire demons …! !! With erotic breathing and sexual harassment posing guidance, the meat pillar is erected and all concentrated fin

  • amateur censoredcreampiebig titsntkntk-523ntk523300ntk-523
    • 2021-02-22
    106 min

    [PPMNB-106]Refreshing Teen Diary Your Smile Is So Beautiful Natsumi Furukawa

  • censoredbig titsbeautiful girlPPMNBintec incPPMNB-106PPMNB106h-706ppmnb00106
    • 2021-02-22
    115 min

    [PRBYB-071]Instinctive Nude H[

  • censoredbig titsbeautiful girlPRBYBintec incPRBYB-071PRBYB071h-706prbyb00071
    • 2021-02-28
    160 min

    [LULU-057]When I Discovered That My Son's Wife (The One With Light Skin And Big Tits) Was The Legendary, Former No.1 Sex Club Girl, In Return For My Silence, She Gave Me Some Serious Pussy Pounding Sex And Let Me Creampie Her Over And Over Again

  • tsujii honoka censoredcreampiebig titsLULUlunaticsvagmanLULU-057LULU057lulu00057
    • 2021-03-10
    56 min

    FC2PPV 1719932 [New work until March 17th 1980PT → 1600PT] Apply for 3P! 30-year-old huge breasts G cup beauty and 3P raw squirrel cum shot! !! Shake the huge breasts and get excited and roll up! !! [High image quality]

  • amateur uncensoredfc2
    • 2021-03-12
    112 min

    [FTHT-009](Shocking Silent Goddess Swooning With Earth-Shattering Orgasms!) Face-Fucked While Laying On Her Side - See The Cock Bulge In Her Cheeks! She Takes Every Thrust With Teary Eyes! She Cums Over And Over Again For The Camera, Her Back Arched

  • censoredcreampiesquirtingFTHTfalenodavielfalenotubeFTHT-009FTHT0091ftht00009
    • 2021-03-19
    54 min

    328HMDN-346 [W Demon Cock 3Px Married Woman] Married Woman Aina 37 Years Old Wife Who Was Addicted To 3P With Intense Pleasure! From the top to the bottom, if you keep dying the lewd pussy of your cheating wife who is happily numb to the merciless pi

  • amateur censoredcreampiemarried womanhmdnhmdn-346hmdn346328hmdn-346
    • 2021-03-27
    56 min

    230OREX-216 Ichika-chan

  • amateur censoredcreampieuniformorexorex-216orex216230orex-216
    • 2021-04-01
    148 min

    [GOJU-179]No Warning!! A Fifty-Something Mature Woman Who Came To Work A Blowjob Is Suddenly Providing Opportunities For Oral Ejaculation! 2

  • censoredamateurblowjobGOJUfifty somethingGOJU-179GOJU179h-1165goju00179
    • 2021-04-08
    130 min

    [MEKO-209]New "Rental MILF" Service 12 - They Say You Can Give Them A Creampie So We Tried Asking For Even More Extreme Services

  • censoredcreampieamateurMEKOmilf laboMEKO-209MEKO209h-1160meko00209
    • 2021-04-09
    201 min

    [IPX-634]FIRST IMPRESSION 148 Best In The Reiwa Era, Beautiful Y********l With Short Hair Who Doesn't Look Like A Porn Star Kotomi Ono

  • kotoyumi ono censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-634IPX634ipx00634
    • 2021-04-15
    135 min

    [TSF-018]Bad Boy (20) Wakes Up In The Morning To Find He's Turned Into A Girl - Every Detail Covered! "Hey! Stop It - I'll Mess You Up, Bro!" Getting Drilled Awakens Her New Feminine Instincts Yudai Horie

  • yudai horie censoredcreampiebig titsTSFkaguyahimept mousouzokugynecomastia reportTSF-018TSF018tsf00018
    • 2021-04-22
    122 min

    [GS-384]While My Parents Were Away My Step-Cousin From The Country Stopped By For A Visit! I Thought She Was Still Way Too Young But Wow Has She Ever Grown Up, And Now She's Innocently Flashing Her Panties, And Letting Me See Her Change, And She&

  • censoredGSsosoru x garconred ballGS-384GS3841gs00384
    • 2021-05-08
    102 min

    [EKDV-660]While My Parents Were Away ... We Orgasmed With Deep And Rich French Kisses! My Private Tutor Is A Sadistic Bitch With Black Hair Who Gave Me A Mean Handjob And I Gave In To Her Temptation And Ejaculated, Over And Over Again Mahiro Ichiki

  • mahiro ichiki censoredschoolgirlsingle workEKDVcrystal eizoe kissEKDV-660EKDV660ekdv00660
    • 2021-05-08
    149 min

    [USAG-028]"Just Your Kiss Is Getting Me Wet." I-Cup Amateur Girls - Colossal Tits / Chubby / Petite / Rural / Blowjob Lover / Creampie Sex

  • censoredcreampiebig titsUSAGrabbit daydreamersUSAG-028USAG028usag00028
    • 2021-05-08
    245 min

    [KDMI-035]High Leg Fantasy Amazing

  • kimishima mio yano tsubasa censoredKDMImiludopamixKDMI-035KDMI035kdmi00035
    • 2021-05-29
    41 min

    FC2PPV 1742511 Mosaic collapse version ❤️ Hostess Anna and active JD Yuka ❤️ First co-starring work with purchase privilege

  • amateur uncensoredfc2
    • 2021-06-16
    155 min

    [DVDMS-679]This Hotel Cleaning Lady Was Wearing Some Tight Ass Pants, And I Could No Longer Resist, So I Shoved My Big Dick In From Behind And Got Myself A Quickie! "But I Have A Husband ..." She Tried To Protest, But This Manly Male Guest Ma

  • censoredamateurDVDMSdeep sswing nagaseDVDMS-679DVDMS679dvdms00679
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-08
    56 min

    FCP-028 [Delivery only] That girl who cares is a little devil! ？？ You cannot escape from the absolute realm. [Leg fetish must-see] Pleasure cum thigh job

  • amateur censoreduniformschoolgirlfcpfcp-028fcp028fcp-028
    • 2021-07-09
    117 min

    [MEYD-688]The Truth is, I'm Continuing to be Fucked by my Husband's Boss... Wan Horikita

  • horikita wan censoredcreampiesingle workMEYDtameike gorohirokoji osakiMEYD-688MEYD688meyd00688
    • 2021-07-09
    240 min

    [MIZD-240]2 Minutes Before the Bitch who Loves Sucking Dick Ejaculates Last Spurt Fellatio 120 in a Row

  • nanasawa mia hatsukawa minami censoredblowjobslutMIZDmoody smoodyz bestMIZD-240MIZD240mizd00240
    • 2021-07-10
    130 min

    [AVSA-172]SUPER FISHEYE FETISHISM Voluptuous Nympho Nurse's Thick Curves Honami Akagi

  • honami akagi censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-172AVSA172avsa00172
    • 2021-07-15
    150 min

    [ABW-117]スプラッシュ杏 脱水不可避！8.9リットル放出！驚異の6SEX 蜜美杏 【MGSだけのおまけ映像付き 15分】

  • amateur censoredbig titssquirtingabwabw-117abw117abw-117
    • 2021-07-22
    13 min

    Caribbeancom 072221-001 The Undisclosed: The shy Spring Show 12 Hasumi Yoshioka

  • amateur uncensoredcaribbeancom
    • 2021-08-01
    122 min

    [NACR-450]Hold Me... A Single Mother Who Fell In Love With Her Neighbor - Miu Arioka

  • arioka miu censoredcreampiebig titsNACRplanet plusdirector oshichi ku ryuuNACR-450NACR450h-237nacr00450
    • 2021-08-03
    149 min

    [SDAB-187]Alone Until Morning With Neighborhood Gangster Daddy After School. Fresh Pussy Overflowing With Semen In First Raw Fuck Creampie, Non Hanakado

  • kamon non censoredcreampiesoloworkSDABsod creategoemonseishun jidaiSDAB-187SDAB187
    • 2021-09-03
    179 min

    [MIFD-176]Newcomer, 19 And Half, Y********l. She Wants To Be An Adult. JAV DEBUT Kazuna Yuuki

  • kazuna yuki censoredbeautiful girlsingle workMIFDmoodyzusapyonmoodyz freshMIFD-176MIFD176mifd00176
    • 2021-09-29
    59 min

    494SIKA-112 Gully Small Tits J ○ And 3P Sex

  • amateur censoredamateurbukkakesikasika-112sika112494sika-112
    • 2021-10-01
    128 min

    [JUTA-123]4 Years Since Then... Reborn, Ryoko Tachibana 47 Years Old, Super Slender Hot Wife"s First Creampie Threesome

  • ryoko tachibana censoredcreampiemature womanJUTAjuku onna japan emmanuelletokugawa museijuku onna japanJUTA-123JUTA123juta00123
    • 2021-10-01
    120 min

    [NACR-462]A Step Uncle And His Son Were Lured To Temptation By A Horny Newlywed Step Niece! Haruki Ashina

  • haruki ashina censoredslutsingle workNACRplanet plussakura ninshichi ku ryuuNACR-462NACR462h-237nacr00462
    • 2021-10-08
    164 min

    [SSIS-208]This Knockout Model Desperately Wants To Suck And Fuck After Being Celibate For A Month! Starring Kaoru Yasui

  • kaoru yasui censoredbig titssingle workSSISs1 no 1 stylearashiyama michiruSSIS-208SSIS208ssis00208
    • 2021-10-09
    129 min

    [DNJR-060]Urethral Violation School

  • ichika matsumoto rina takase censoredsluthandjobDNJRinu mousozokunikukuso tei haramiDNJR-060DNJR060dnjr00060
    • 2021-10-15
    123 min

    [MUDR-165]Language, Math, Science, And Sex Service Documentary. After Her Afternoon Lessons She Studies For Her Dream Of Working In Sex Service - Full Story.

  • himesaki hana rumi tadami censoredschoolgirlblowjobMUDRmukuMUDR-165MUDR165mudr00165
    • 2021-10-23
    79 min

    200GANA-2584 Seriously Nampa, First Shot. 1706 Cusso Cute And Fashionable, But A Gamer And Neat Gap! Slender, Beautiful Legs, Nice Ass And Big Breasts! The Expression That Is Distorted Every Time The Sensitivity Is Also Preeminently Struck! This Woma

  • amateur censoredbig titsamateurganagana-2584gana2584200gana-2584
    • 2021-11-04
    54 min

    422ION-0084 Gonzo At The Hotel With A Senior At The Same Part-Time Job Without Telling Her Boyfriend (Ayumi Aika)

  • amateur censoredamateurbeautiful girlionion-0084ion0084422ion-0084
    • 2021-11-06
    57 min

    [CSDX-017](4K) Cosplay x Aoi Kururugi 6 - Aoi Kururugi

  • aoi kururugi censoredblowjobcosplayCSDXcosdeluxeCSDX-017CSDX017h-1558csdx00017
    • 2021-11-11
    103 min

    [ZEAA-067]Married Woman Alice Otsu Turned On By Bondage, Training Request Collection

  • otsu alice censoredcreampiemarried womanZEAAcenter villagemurakithe pole center villageZEAA-067ZEAA067h-086zeaa00067
    • 2021-11-20
    80 min

    534IND-013 Onikawa Bishoujo Bitch God Correspondence! !! The Face Is The Best, But The Tongue Is Also A God … Rebet Hospitality Mashimashi Great Satisfaction P Activity! !! (Urara Kanon)

  • amateur censoredcreampieamateurindind-013ind013534ind-013
    • 2021-11-22
    66 min

    OREX-324 Miku-chan (Miku Kurusu)

  • amateur censoredcreampieschoolgirlorexorex-324orex324orex-324
    • 2021-12-11
    242 min

    [UMSO-426]16 Beautiful Women With Beautiful Body Lines And Net Tights That Are More Disgusting Than Naked.

  • ichika kamihata ayano kato censoredbig titsUMSOk m produceumanamiUMSO-426UMSO426umso00426
    • 2021-12-27
    109 min

    [MDVHJ-045]Mother Forgets Herself And Comes To Her Senses At The Sight Of Her Daughter"s Husband"s Huge Cock... Chapter 2: Yoshizumi Ikeya

  • kazumi ikeya censoredbig titssingle workMDVHJgraffiti japanmovieMDVHJ-045MDVHJ04548mdvhj00045
    • 2021-12-31
    126 min

    [RBK-034]A Showroom Of Sluts. Anal Sex For The Deceived New Wife. Moe Hazuki

  • moe hazuki censoredanalsingle workRBKattackerskaoru okuzonoryupakuRBK-034RBK034rbk00034
    • 2022-01-07
    63 min

    FC2PPV 2577385 [No First Shot] Successful Pick-Up In Kabukicho! Same Day Gonzo E Cup Big Breasts 19 Years Old Kaede-Chan I Also Cheated On Vaginal Cum Shot With Her Glue W [Personal Shooting]

  • amateur uncensoredfc2
    • 2022-01-21
    145 min

    [ROYD-079]I Had Sex With My Slutty Sister-in-law Who Would Let Me Fuck Her Once If I Had A Rubber. Riria Hido

  • riria hido censoredcreampiesisterROYDroyalkawajirihhh groupROYD-079ROYD079royd00079
    • 2022-01-22
    241 min

    [SUPA-606]Beautiful Women With The Ultimate Beautiful Bodies And Big Tits - Creampie SEX 50 People, 4 Hours BEST

  • censoredcreampiebig titsSUPAskyu shirotok taroSUPA-606SUPA606supa00606



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored