hours more big tits pov censored




FC2LULUHZGDATIDBBANBLKAUKSAVSAVEMAFSDSSMIAASPRDCESDSSISHUNTBNGODMARAAPODJUFEMIDVKBI

2020-11-17
55 min

C0930 ki201117 Chinatsu Imaizumi 20years old

  • amateur uncensoredc0930
    • 2020-11-26
    486 min

    [FERAX-008]This Is What Happened When I Fed My Stepmom Some Aphrodisiacs... My Friend From Class Got His Hands On This Illicit Potion, And So I Fed It To My Stepmom, Who Had Long Since Lost Her Allure As A Woman, And That Got Her Seriously In The Moo

  • censoredcreampiemarried womanFERAXcenter villageparadise center villageFERAX-008FERAX008h-086ferax00008
    • 2020-11-28
    76 min

    300MAAN-604 [Puriketsu Bishoujo JD / Nurskos / Creampie & Facials] Maki from a rural area who is not familiar with Tokyo is lonely and masturbates 5 times a week! !! I’m shy, but in fact, it was my favorite Erokawa JD! !! In the reward of su

  • amateur censoredamateurcosplaymaanmaan-604maan604300maan-604
    • 2020-12-05
    123 min

    [HUNBL-023]I Suddenly Got A New Mother-In-Law And She Turned Out To Be A Super Horny Bitch With A Full Body Tattoo! My Dad Got Remarried To A Young And Beautiful Lady, And She Was Super Nice! But She Had Tattoos All Over Her Body, And She Was A Super

  • censoredcreampiehandjobHUNBLhunteraldebaranhhh groupHUNBL-023HUNBL023hunbl00023
    • 2020-12-26
    47 min

    [per-358]れんか 2

  • amateur censoredamateurblowjobperper-358per358per-358
    • 2021-01-02
    189 min

    [UMD-764](Daily Erotica) I Just Happened To Cum Upon A Dream-Cum-True Erotic Situation, And Usually I Would Never Get To Fuck A Girl Like This, But Here We Present To You A Lucky Fuck (6 Stories)

  • jinguji temple nao ayumi shinoda censoredbig titsUMDleotabu osakiUMD-764UMD764125umd00764
    • 2021-01-06
    120 min

    [GVH-177]Family Affair Yurika Aoi

  • yurika censoredcreampiemomGVHglory questkabin kizakuraGVH-177GVH17713gvh00177
    • 2021-01-08
    56 min

    10musume 010921_01 The Structure Of Woman : I have released the limiter beyond embarrassment Ryoko Akahori

  • amateur uncensored10musume
    • 2021-01-10
    300 min

    [DVAJ-496]The Girl I Love Stolen Right In Front Of My Eyes

  • kawakami nanami freedom censoredcreampieDVAJalice japansagi kandaDVAJ-496DVAJ496dvaj00496
    • 2021-01-13
    45 min

    302GERK-340 Toa

  • amateur censoredcreampieamateurgerkgerk-340gerk340gerk-340
    • 2021-01-22
    230 min

    [PARATHD-3075]I Managed To Fuck 20 Female Therapists From Regular Massage Parlors. 4-Hour Special (2)

  • censoredPARATHDparadise tvPARATHD-3075PARATHD3075parathd03075
    • 2021-01-29
    46 min

    FC2PPV 1664337 [Personal shooting] Yan Mama and Enko with a child who came to Tokyo from the countryside! A strange cock sucking lust for a child [Creampie]

  • amateur uncensoredfc2
    • 2021-01-30
    168 min

    [JUFE-254]She Was A S********l Just A Second Ago - Now This Beautiful Girl's Making Her Porn Debut! Miyu Yokozawa, Age 18 - A Quarter Russian, This Is The Shaved Pussy Teen Of Your Dreams, And She's Ready To Squirt In Orgasmic Ecstasy

  • mimu yokozawa censoredsquirtinguniformJUFEfitchJUFE-254JUFE254jufe00254
    • 2021-02-18
    120 min

    [SSNI-991]I Met My Cousin (She's Still Growing) For The First Time In Years, And She Had Gotten So Good At Her Nookie SK**ls That I Could No Longer Resist, And Spent 3 Days And 3 Nights Squeezing Out 18 Cum Shots In A Row During My Visit Home, An

  • yura kanno censoredbeautiful girlsingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-991SSNI991ssni00991
    • 2021-02-19
    120 min

    [AQSH-065]Careless Wives On Skype - My Busty Neighbor Has Fallen Into My Trap... Hana Himesaki

  • himesaki hana censoredcreampiebig titsAQSHaquamall heroaquamallAQSH-065AQSH065aqsh00065
    • 2021-02-22
    106 min

    [GREDB-1022]I Love The Feeling Of A Asuka Hashida

  • censoredbig titsbeautiful girlGREDBintecGREDB-1022GREDB1022h-706gredb01022
    • 2021-02-23
    69 min

    326EVA-162 [4 barrage of vaginal cum shot! ] Looks beyond the perfect model! !! In the daytime, a caregiver’s girls bar cast and a gonzo part-time job are established ☆ A metamorphosis kiss sommelier that you can feel the compatibility of Ji Po

  • amateur censoredcreampieamateurevaeva-162eva162326eva-162
    • 2021-02-27
    60 min

    SIRO-4429 [First shot] [Flowing delicate body] [Penetrating big cock ..] A professional student who wants to make up, fascinating cuteness like a small animal. It must have been a revenge for the boyfriend who was cheating .. AV application on the ne

  • amateur censoredamateursirosiro-4429siro4429siro-4429
    • 2021-03-06
    159 min

    [BBAN-316]Nozomi Arimura Is Lifting Her Shame Ban She'll D***k Every Last Drop Of Piss A Super Piss-Sucking, Golden Showering Lesbian Series

  • arimura nozomi misaki azusa censoredlesbianBBANbibianBBAN-316BBAN316bban00316
    • 2021-03-23
    59 min

    326HGP-007 [Dirty Angel, Advent! !! ] The fascinating hip line is a lump of eros ♪ Full operation of the sperm factory with a back muscle blowjob like licking candy ⇒ 2 consecutive shots confirmed! !! Yoga goes crazy for vaginal cum shot SEX with tip

  • amateur censoredcreampieamateurhgphgp-007hgp007326hgp-007
    • 2021-04-02
    116 min

    [ATID-459]A Big Black Dick Is Fucking My Anus! Elly Akira

  • aki erie arai erie yuka osawa censoredmature womansingle workATIDattackerseitaro hagaein madATID-459ATID459atid00459
    • 2021-04-02
    140 min

    [YMDS-026]Hot And Steamy Deep Kiss Sex At Home The Day Madoka Shizuki

  • madoka shizuki censoredcreampieblowjobYMDSmomotarou video publishingyoung peachYMDS-026YMDS026ymds00026
    • 2021-04-15
    120 min

    [KAGP-179]A Naked Field Guide To Amateur Girls 17 - 12 Modern Sluts In The Buff Thoroughly Filmed Just For Kinky Gentlemen's Nudes Collections

  • censoredamateurbeautiful girlKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-179KAGP179kagp00179
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-29
    124 min

    [XVSR-593]Steamy Sex MAX-A Exclusive Actresses Ichika Mogami's First Time Having Real Adult Sex

  • ichibana mogami hana sato censoredbig titssquirtingXVSRmax ak c takedacalenXVSR-593XVSR593xvsr00593
    • 2021-06-05
    123 min

    [PKPD-145]Amateur Fuck Buddy Documentary - Lightly Buzzed Creampie Sex With Fragrant Pretty Office Lady In Pantyhose - Hana Shirato

  • white peach censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-145PKPD145pkpd00145
    • 2021-06-16
    120 min

    [FOCS-003]A Sexually Aggressive Big Tits JD She Can No Longer Stand Being Deprived Of Sex By Her Boyfriend! She Loves To Give A Blowjob And She's Got A Bottomless Well Of Sexual Lust She Can Never Resist The Temptation To Have Sex, And Will Secre

  • censoredbig titsamateurFOCSabc mousouzokufocusFOCS-003FOCS003focs00003
    • 2021-07-02
    68 min

    FC2PPV 1899108 066 [Creampie & Facials] Creampie & Infinite Facials Sex with a Big-Chicked Adult 1st Year OL On The Way To Work (Big Breasts x God Style x Bukkake)

  • amateur uncensoredfc2
    • 2021-07-05
    79 min

    300NTK-592 [Only pure won! !! Natural beautiful girl clerk’s norinori cowgirl! !! ] Gachi beautiful girl angel who landed in the pharmacy! !! Pretending to be an innocent system with a sense of transparency … Misleading a man and really lov

  • amateur censoredcreampieamateurntkntk-592ntk592300ntk-592
    • 2021-07-10
    151 min

    [APKH-180]Going With an Angelic, Innocent Beauty on a Hot Spring Vacation and Staying Indoors Filming Us Having Sex. This Ultra-Sensitive Masochistic Class President Cums as Soon as It Goes In! Hana Shiramomo

  • white peach censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-180APKH180apkh00180
    • 2021-07-14
    65 min

    495MOJ-011 "riko & Arisa" Of A Good Friend Duo With A Lesbian After School Orgy

  • amateur censoreduniformamateurmojmoj-011moj011495moj-011
    • 2021-07-15
    140 min

    [071521_001]セクシー女優スペシャル版 ～ 長谷川美裸 みほの

  • amateur uncensored1pondo
    • 2021-08-02
    66 min

    SIRO-4591 [First Shot] [Sensitive Glossy Skin] [Cum Every Minute] Sensitive Body Nursery Teacher Who Switches On Immediately. Every Time I Die, My Body Seems To Be Irritable And Repeats Countless Cums .. AV Application On The Net → AV Experience Shoo

  • amateur censoredamateursirosiro-4591siro4591siro-4591
    • 2021-08-13
    60 min

    10musume 081421_01 A Call Girl In A Nurse Costume Who Even Gives You A Cleaning Blow Job Haruna Kawai

  • amateur uncensored10musume
    • 2021-08-14
    101 min

    390JAC-105 [God Body = Huge Breasts + Extreme Ass + Overwhelming Beauty = Ririko! !! !! 4 Consecutive Vaginal Cum Shot] Get Wild And GAL! !! !! If You Need A GAL, Write These Three Letters On The Bulletin Board At Shibuya Station … "GAL"

  • amateur censoredcreampiebig titsjacjac-105jac105390jac-105
    • 2021-09-10
    119 min

    [IPX-721]The Strongest Martial Artist Ema Gets A Secret Remedy That Makes Her Into The Weakest Girl And I Have Fun With Her From The Strongest To The Weakest She Now Gets G*******ged!! Ema Futaba

  • futaba emma censoredschoolgirldeepthroatIPXidea pocketzaku araidishIPX-721IPX721ipx00721
    • 2021-09-15
    118 min

    300MIUM-746 [Second Iki Premature Ejaculation Beauty] Emergency Assault On An Amateur’S House During Masturbation. Sensitivity After Crispy Max.

  • amateur censoredbig titsamateurmiummium-746mium746300mium-746
    • 2021-09-16
    126 min

    [JRZE-077]First Time Filming My Affair, Akiho Ishibashi

  • akiho ishibashi censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-077JRZE077h-086jrze00077
    • 2021-09-21
    542 min

    [OOMNVD-001]Sex Since Daytime where You Forget Time and Seek Pleasure from Each Other Single-Mindedly like Animals

  • yukino nagi tsukino luna censoredbig titsmarried womanOOMNVDabc delusion groupmom.com abc delusion groupOOMNVD-001OOMNVD001oomnvd00001
    • 2021-10-01
    34 min

    FC2PPV 2281430 [No] [Limited To 100 Pieces 2980 → Off To 1480pt!] Excited To Be Seen By People! Metamorphosis Beauty ♥ ️ Even Though I Have A First-Class Secretary Test … Lol, ♥ ️ Massive Vaginal Cum Shot! !! ♥ ️ * Review Benefits / High Image Q

  • amateur uncensoredfc2
    • 2021-10-23
    241 min

    [MDBK-205]Her Big Smile And Smooth Skin Make Me Crazy!! Modern S********l"s Demands!!! Temptation Best 50 Selection!!!

  • inaba miku abe censoredcreampieslutMDBKbazookataro kMDBK-205MDBK205mdbk00205
    • 2021-11-10
    62 min

    SIRO-4701 [First Shot] [Glossy Sex Appeal] [Continuous Cum At The Woman On Top Posture] A Frustrated Tall Office Lady Who Has A Mature Erotic Body Appears. When A Big Cock Is Inserted Into A Secret Part That Gets Wet And Shines, It Reveals Pleasure W

  • amateur censoredamateursirosiro-4701siro4701siro-4701
    • 2021-12-04
    53 min

    C0930 hitozuma1368 Fusako Yokoyama 29years old

  • amateur uncensoredc0930
    • 2021-12-04
    88 min

    [BAB-040]Japan"s Outstanding Talent. A Certain Winner of a Girl. Mizuki Amane

  • natural mizuki censoredhandjobsingle workBABbabylon daydreamersBAB-040BAB040bab00040
    • 2021-12-24
    119 min

    [ROE-034]MONROE Exclusive. Educated Elite Wife Round 2!! Had Creampie Sex With Wife of Boss Who I Had A Crush On For 10 Years Before We Parted. Suzuka Kisaki

  • kisaki suzuka censoredcreampiemature womanROEmadonnaunicorn fukudamonroeROE-034ROE034roe00034
    • 2021-12-24
    146 min

    [JUL-800]"Unaware Beauty" Who Doesn"t Realize Her Own Beauty. Umi Oyokawa(29) Porn Debut. Fact That She"s So Close To Peak And In Reach Is Unfair.

  • oikawa umi censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-800JUL800jul00800
    • 2022-01-07
    122 min

    [JUL-833]Married Woman Brainwashing: A Married Woman Corrupted By Her Neighbor"s Sex Service Man - Riho Fujimori

  • riho fujimori censoredbig titsmature womanJULmadonnaichitaro moroboshiJUL-833JUL833jul00833
    • 2022-01-10
    240 min

    [016HEZ-360]コタツの中でこっそり悪戯 2 義母に中出し近親○姦！不倫美熟女の股間にズボッ！ 17名

  • amateur censoredcreampiemarried womanhezhez-360hez360016hez-360
    • 2022-01-22
    169 min

    [DGCEMD-118]Limited Availability! Includes Bonus Footage! 5 Seconds Before This Dick Loses It! Uncompromising Teasing Full Course Slut SEX 3. Luna Tsukino.

  • tsukino luna censoredmature womanslutDGCEMDcelebrity friendsDGCEMD-118DGCEMD118dgcemd00118
    • 2022-01-28
    59 min

    [WKD-050]Record Of Sex During A Secret Meeting With An Adulterous Married Woman. Ayane Sezaki.

  • ayane sezaki censoredbig titsslutWKDwaap entertainmentk westwWKD-050WKD0502wkd00050
    • 2022-02-12
    88 min

    [HOKS-114]Record Of Crazy Family"s Fuckfest! Winter Fakecest

  • natsuna sasaki tamaki walnut censoredbig titsmature womanHOKSfa prokinzo ogurokkuHOKS-114HOKS114hoks00114
    • 2022-02-25
    163 min

    [506HOMEV-030]ひなこ

  • amateur censoredamateurhomevhomev-030homev030506homev-030
    • 2022-02-26
    129 min

    [SOAN-072]The Dream Of A Step-family Of 5 For Sexual Satisfaction (2 Holes) Toxic Step-mom That Wants A Fakecest Family. Step-dad With A NTR Cheating Fetish And The Rest Of The Step-family Need Lewd Anal Lessons To Train Them. Yukari-san. (46)

  • censoredSOANyama to soramaketaro tanizokoanal visitSOAN-072SOAN072soan00072
    • 2022-03-04
    160 min

    [HODV-21658](All Peeping) She"s Not A Call Girl But This Men"s Massage Parlor Girl Is Booked 3 Months In Advance For A Secret Option That"s Just Too Lewd...

  • censoredcreampiesquirtingHODVh m pHODV-21658HODV216585642hodv21658
    • 2022-03-08
    57 min

    230ORECO-006 Nozomi-Chan (Kawasaki Nozomi)

  • amateur censoredcreampiebig titsorecooreco-006oreco006230oreco-006
    • 2022-04-01
    120 min

    ATID-504 The Unlimited Service Of The Pathetic Servant, Who Is A Fresh Face Female Office Worker. Nanase Asahina

  • asahina nanase censoredATIDattackersring researchin madATID-504ATID504atid00504



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored