hours more creampie housewife cuckold ntr javcensored




FC2CJODIPXMVSDSHKDNACRNNPJFSDSSAWDMEYDMARACHRVMILKCESDSANDASDVEMAMIDVABWHODVATID

2021-01-01
76 min

345SIMM-587 The school’s number one diva wants to pant (sing) only to her uncle! Ma-ji-de-cute unfussy beautiful girl J ○ holds Ji-ko instead of a microphone and sings a big sweet Kyun SEX on the bed! !! !! “(If you win the game) Eat your u

  • amateur censoreduniformschoolgirlsimmsimm-587simm587345simm-587
    • 2021-01-08
    181 min

    [PIYO-098]I Want To Live Off Your Womb - Ever Since I Was Young I Knew I Wanted To Be A Gynecologist. Now I Finally Have My Very First Patient, A Y********l Who's Everything I Hope She Would Be, And Now I Get To Explore Her Inside And Out.

  • censoredcreampieschoolgirlPIYOhyokopiero dagrey wolfPIYO-098PIYO0981piyo00098
    • 2021-01-21
    93 min

    [OKS-104]Tight, Soaking Wet, Clinging To Every Curve - Have Your Fill Of Cute Sluts In School Swimsuits! Hidden Camera Voyeur Footage In The Change Room Of Shaved Pussy, Hairy Pussy, Big Tits, Small Tits, Armpit Stubble, And More - Close-Up Fetish An

  • horikita wan censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-104OKS1041oks00104
    • 2021-01-23
    143 min

    [JUL-441]She Might Be A Cougar, But She's Still Cute - She Might Be Cute, But She's Still Nasty. Natural Succubus, Man-Eating MILF Marika Kobayashi, Age 46, Makes Her Porn Debut!

  • marika kobayashi censoredmature womansingle workJULmadonnamametaro mamezawaJUL-441JUL441jul00441
    • 2021-02-06
    112 min

    240TOKYO-407 Narumi

  • amateur censoredamateurcosplaytokyotokyo-407tokyo407240tokyo-407
    • 2021-02-15
    49 min

    FC2PPV 1687864 [First time limited 1980] That natural beauty big breasts G cup ❤️ The size of the boobs has increased ❤️ H cup fair body ❤️ A large amount of vaginal cum shot again in a very narrow pussy ❤️ * Review privilege “Squirting challeng

  • amateur uncensoredfc2
    • 2021-02-21
    147 min

    [CAWD-183]Fingering Her With The Cute Kansai Dialect - Twirl, Twirl - "You Can't Cum Yet!" Stuck In Between Two Kansai Girls, I Had A Reverse Threesome Until My Dick Almost Broke - Nana Maeno, Kokomi Hoshinaka

  • nana maeno kozomi hoshinaka censoredsquirtingbeautiful girlCAWDkawaiiarashiyama michiruCAWD-183CAWD183cawd00183
    • 2021-02-25
    40 min

    [GRMO-025]ニンゲン観察 バーでナンパされ、出会ったばかりの男と酒の勢いでワンナイトSEX

  • censoredGRMOmura chblood clam abaloneGRMO-025GRMO025h-1534grmo00025
    • 2021-02-26
    82 min

    230OREC-705 Yuki

  • amateur censoredmarried womanamateurorecorec-705orec705230orec-705
    • 2021-03-01
    153 min

    [DOKS-537]New - Sexually Frustrated Wives Watch People Jack Off No. 4

  • censoredamateurblowjobDOKSofficeDOKS-537DOKS53736doks00537
    • 2021-03-11
    480 min

    [DANDY-753]There's Always A Reason For Sex! 10 Kind Nurses Who Help Out Their Horny Patients

  • censoredcreampiebig titsDANDYdandykikujiro otsuDANDY-753DANDY7531dandy00753
    • 2021-03-27
    130 min

    [SQTE-364]If Only I Could Spend The Day With My Sex Starved Girlfriend Chiharu Miyasawa

  • chiharu miyazawa censoredblowjobbeautiful girlSQTEs cuteSQTE-364SQTE364sqte00364
    • 2021-03-30
    56 min

    499NDH-011 Delivery is a part of daddy activity! ？？ The true identity of the fluffy beautiful girl with a naive atmosphere was a daddy active girl! Sales activities at the delivery destination! Azatoi Hanikami Take out the delivery-chan with the high

  • amateur censoredcreampieamateurndhndh-011ndh011499ndh-011
    • 2021-04-14
    144 min

    [MVSD-461]MILF Abandons Her Husband And Son To Ride All The Hot Young Cock At Her Part-Time Job - Her Sensitive Body Is Brimming With Breast Milk - And Squirting It All Over When She Cums Hard Hinami Narusawa

  • hinami narusawa censoredcreampiebig titsMVSDm s video groupMVSD-461MVSD461mvsd00461
    • 2021-04-18
    68 min

    FC2PPV 1775865 [T ● Many appearances] An older sister from the Race Queen unit. Cum 10 barrage

  • amateur uncensoredfc2
    • 2021-04-18
    126 min

    [APNS-238]Stepsister Swap - How To Wreck A Family Mitsuha Higuchi Sumire Kurokawa

  • mitsuha higuchi sumire kurokawa censoredcreampiedramaAPNSaurora project annexyukihiro nasuaurora project anexAPNS-238APNS238apns00238
    • 2021-04-22
    66 min

    336KNB-151 A Wife With A Sexual Desire Who Has Just Give birth Is Not Satisfied With Her Husband’s Sex And Applyes For AV! !! Roll up while spraying breast milk! !! Instinct bare sex that faints in agony with an actor’s big cock! !! !! I wi

  • amateur censoredmarried womanamateurknbknb-151knb151336knb-151
    • 2021-05-14
    79 min

    FC2PPV 1817900 [3480 → Limited number 2480] [First shot ㊙️ Video] Only seen as an adult J’s K ❤️ Nurse dreaming 18 years old ❤️ Enjoy the immature body of one experienced person ❤️ Tell me a safe day and insert raw Massive vaginal cum shot ❤️

  • amateur uncensoredfc2
    • 2021-05-22
    167 min

    [DGCEMD-011]*Delivery Only! Bonus Video Included* 5 Seconds Before The Cock Breaks! A Full-course Slut Who Doesn't Hold Her SEX Back - Honoka Tsujii

  • tsujii honoka censoredbig titsblowjobDGCEMDcelebrity friendsDGCEMD-011DGCEMD011dgcemd00011
    • 2021-06-18
    44 min

    FC2PPV 1873223 [Individual shooting] Minami 19 years old Innocent and innocent beautiful girl! A plump body that can conceive a body even if it has a Ubu personality! Two consecutive vaginal cum shots with lust for an obedient super beautiful girl!

  • amateur uncensoredfc2
    • 2021-06-23
    59 min

    Caribbeancom 062321-001 Debut Vol.68 : Continuous vaginal cum shot to the first take off former gravure idol with a smile Asami Ishida

  • asami ishida uncensoredcreampiecaribbeancom
    • 2021-07-14
    121 min

    [FOCS-009]Beautiful princess with big tits in a dirty room. Naive female celebrity is trained to climax and explore being dominated! Mei Satsuki.

  • satsuki mei censoredcreampiebig titsFOCSabc mousouzokufocusFOCS-009FOCS009focs00009
    • 2021-07-18
    140 min

    [DBER-118]The Lusty Beast Hunting Club The Cruel Tantalizing Of A Limber-Limbed Sacrifice - A Bewitchingly Beautiful Girl Cums In Hell - Part 8: The Tears And Roars Of The Robustly Sweet Nectar Of A Flesh Fantasy Doll Nanami Ozora

  • nanami ozora censoredbdsmsingle workDBERbabyentertainmentkikubonred babeDBER-118DBER118dber00118
    • 2021-07-20
    61 min

    1Pondo 072021_001 Experience Anal SEX for the first time! Kurumi Tokito

  • amateur uncensored1pondo
    • 2021-08-11
    96 min

    [ETQR-269][Daydream POV] Temptation Of, And Sex With, A Slut And Beautiful Girl, Marina Saitou

  • marina saito censoredcreampieuniformETQRerotic timeETQR-269ETQR269etqr00269
    • 2021-08-19
    61 min

    230OREC-857 Kanna

  • amateur censoredcreampieamateurorecorec-857orec857230orec-857
    • 2021-08-30
    45 min

    358WITH-103 Haruna (21) S-Cute With Bath Chopsticks Gonzo H

  • amateur censoredamateurbeautiful girlwithwith-103with103358with-103
    • 2021-09-03
    155 min

    [MIAA-490]If You Don"t Want Your Husband Fired Then Be Face Fucked By His Boss Natsuki Takeuchi

  • natsuki takeuchi censoreddeepthroatsingle workMIAAmoodyzakai suiseiminna no kikatanMIAA-490MIAA490miaa00490
    • 2021-09-09
    92 min

    374IMGN-024 Mao

  • amateur censoredamateurbeautiful girlimgnimgn-024imgn024374imgn-024
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-23
    26 min

    FC2PPV 2241339 Unauthorized Vaginal Cum Shot To A Beautiful Ass Young Wife

  • amateur uncensoredfc2
    • 2021-09-23
    205 min

    [CHN-209]新・絶対的美少女、お貸しします。 108 乃木絢愛(AV女優)21歳。【MGSだけのおまけ映像付き 15分】

  • amateur censoredsquirtingamateurchnchn-209chn209chn-209
    • 2021-09-24
    170 min

    [BANK-054]The Creampie Outdoor Bath A Lusty Elder Sister Type With A Slim Body And H-Cup Rocket Tits And Rock Hard Nipples

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-054BANK054h-1495bank00054
    • 2021-10-07
    93 min

    [OKS-121]Yume Natsuki. Wet And Glistening In A Tight Fitting School Swimsuit. Cute Girls In School Swimsuits For Tons Of Wet Fun! Peeping While They Change To See Everything From Small To Big Tits, Shaved Pussy, Pussy Hair, Arm Pits, And Other Fetish

  • natsuki yume censoredschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-121OKS1211oks00121
    • 2021-10-15
    149 min

    [MEYD-713]This Newlywed Wife Moved Into An Apartment Complex Filled With Lowlives Who Took Her To A Big Sex With You Large Orgies NTR Party, With No Birth Control Whatsoever! Hotaru Nogi

  • nogi firefly censoredbig titssingle workMEYDtameike goroMEYD-713MEYD713meyd00713
    • 2021-10-22
    39 min

    FC2PPV 2364568 [Personal Shooting, Orgy, Vaginal Cum Shot, 500p Off For A Limited Time] A Delicate Wife Who Keeps Aching And Prioritizes The Insertion Of Other Sticks Over The House.

  • amateur uncensoredfc2
    • 2021-11-06
    122 min

    [BACN-040]A Compliant Older Sex Friend - My Favorite Person, Who Gave Me All Her Body And Mind - Kanna Shiraishi

  • shiraishi plane censoredcreampieschoolgirlBACNbarutanmaboroshi kocandyBACN-040BACN040bacn00040
    • 2021-11-07
    64 min

    200GANA-2594 Seriously Nampa, First Shot. 1713 A Slender Beauty With A Height Of 173 Cm! It Looks Graceful And I’m Actually Used To Being A Man … Standing Back Has Long Legs That Shine! The Expression That Is Distorted In Pleasure Is Intrig

  • amateur censoredamateurganagana-2594gana2594200gana-2594
    • 2021-11-15
    62 min

    SIRO-4705 [First Shot] [Soft G Cup] [This Is The Sex Appeal Of A Married Woman] A Curious Big-Breasted Married Woman Who Usually Enjoys The Relationship Between Saffle And Immorality Appears. The Wife Who Likes Kissing Violently Exchanged Tongues Wit

  • amateur censoredbig titsmarried womansirosiro-4705siro4705siro-4705
    • 2021-11-19
    141 min

    [JUL-779]"Hey, Are You Really a Cherry Boy？" - The Fake Cherry Boy Makes the Married Woman Come Like Crazy - Kanae

  • ai kano censoredbig titsmature womanJULmadonnatomitake taroJUL-779JUL779jul00779
    • 2021-11-20
    240 min

    [MDBK-210]50 Of The Cutest And Most Adorable Baby Faces! Super Best! You Can"t Imagine How Erotic They Are From Their Cute Faces, And You"ll Be Hooked!

  • inaba scooping censoredcreampiecosplayMDBKbazookak taroMDBK-210MDBK210mdbk00210
    • 2021-11-22
    75 min

    300MIUM-765 [Big Breasts Rocket Launcher Married Woman] Get A Transcendental Sexy Wife Who Walks While Shaking Her Boobs Vine Vine! Mutchimuchi’S Nice Ass Swallowing A T-Back! !! [Impact Extreme Erotic Body] "Don’T Insert It Because The

  • amateur censoredcreampiebig titsmiummium-765mium765300mium-765
    • 2021-12-11
    60 min

    1Pondo 121121_001 Seducing By Flashing Pussy: A Friend Mom Who Clever Cute Asaka Sera

  • amateur uncensored1pondo
    • 2021-12-17
    54 min

    520SSK-040 Mao-Chan’s Belokiss Covered Sex (Mao Watanabe)

  • amateur censoredcreampieschoolgirlsskssk-040ssk040520ssk-040
    • 2022-01-15
    129 min

    [GMEM-055]A Masochistic Wife With A Huge Ass Awakens To Her Lewd Desires With A Whip Installation And Becomes A Dutch Wife

  • censoredbukkakeGMEMavsbuddha davscollector s goldGMEM-055GMEM055gmem00055
    • 2022-01-27
    41 min

    477GRMR-063 Neighbor Is A Horny Older Sister-A Horny Beauty Who Makes An Obscene Voice Every Day And Mutual Masturbation Through The Wall …？ !! ~

  • amateur censoredbig titsamateurgrmrgrmr-063grmr063477grmr-063
    • 2022-01-27
    127 min

    [JRZE-098]First Time Filming My Affair. Naho Fujikawa.

  • fujikawa naho censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-098JRZE098h-086jrze00098
    • 2022-02-10
    61 min

    Pacopacomama 021022_605 Natural Beauty : Ms Otsuki’s Real Face Nono Otsuki

  • amateur uncensoredpacopacomama
    • 2022-02-11
    120 min

    [PPPE-003]Hostess Has Over 80,000 Followers On An App For Short Videos! Influencer With G-Cup Big Tits Makes Her AV Debut In 3, 2, 1... Bang! Akari Azuma

  • azuma akari censoredbig titsPPPEoppaiPPPE-003PPPE003pppe00003
    • 2022-02-14
    86 min

    476FCT-013 Creampie To A Carnivorous Girls Bar Clerk With G Cup Huge Breasts! !! Sensitive Body With Tsundere Temperament Cannot Measure The Number Of Cums! !! (Renka Yamamoto)

  • amateur censoredcreampiebig titsfctfct-013fct013476fct-013
    • 2022-03-11
    120 min

    [MIDV-074]Wife"s First Sex Since Giving Birth By An Erotic Masseur Who Made Her Ab Muscles Contract Unstoppably. Tsubomi.

  • bud censoredcreampiemarried womanMIDVmoody skitorune kawaguchimoodyz divaMIDV-074MIDV074midv00074
    • 2022-04-02
    111 min

    COGM-012 After Practice With The Grumpy Female Bus Captain (With The Wettest Fucking Pussy), We Had A Sticky Sweaty Fuck Date And Came So Hard!

  • censoredamateurCOGMkoguma mouCOGM-012COGM012cogm00012
    • 2022-04-05
    126 min

    AMBI-154 3 Full Days Alone With My Step-sister Who Isn"t B***d-related! We Take The Opportunity To Do Nothing But Fuck Non-stop! Aoi Amano

  • ao amano censoredcreampieschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-154AMBI154h-237ambi00154
    • 2022-04-08
    200 min

    HUNTB-246 The PTA I Have To Go To At The School Has Nothing But Sex Monster Parents？! Every Wife Who Came to the PTA Meeting Seems To Be Sexless And Super Frustrated...

  • censoredcreampieHUNTBhunterkoichi davidsonhhh groupHUNTB-246HUNTB246huntb00246
    • 2022-04-09
    128 min

    SNTX-006 A Salaryman That Takes A Girl To A Hotel, Films The SEX On Hidden Camera, And Sells It As Porn vol. 6

  • censoredamateurbeautiful girlSNTXsojitsusha mousouzokuSNTX-006SNTX006sntx00006
    • 2022-04-16
    124 min

    ZOCM-032 Only Big Dicks Win! We Deliver Sluts. Iroha Minami

  • minami iroha censoredcreampiebeautiful girlZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-032ZOCM032zocm00032



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored