housewife amateur nampa censored jav




FC2MVSDBLKAUKGMIDVMIDEONEZHZGDRBDATIDJUFEHODVBBANMIAASHKDHDKASANSQTEHNDCAWDGVH

2020-12-18
96 min

[VEMA-154]A 3-Day, 2-Night Creampie School Trip Where All The Boys Join So They Can Fuck The Colossal Tits Female Teacher June Lovejoy

  • june lovejoy censoredcreampiemature womanVEMAvenuspetermegami venusVEMA-154VEMA154vema00154
    • 2020-12-18
    310 min

    [YMSR-031]She Competed In The Track-And-Field Inter-College Championships In The 2000s - Now She's Ready For Hardcore Anal Action - MIP Hot Booty Babe - Athlete With Two Gaping Holes

  • censoredYMSRmountain and sky delusion groupsuperb.comboYMSR-031YMSR031ymsr00031
    • 2020-12-21
    240 min

    [ARAN-012]The Crudeness Of The Electric Drill That Will Make Any Woman Go Mad Her Passion Burns Hot In Her Deep Nether Regions 47 Ladies Spasm To Consecutive Orgasmic Ecstasy!! A Dynamite Massive Pictorial INFERNO BABE ULTRA FILM

  • censoredbdsmARANbabyentertainmentshiroto musume kyoso kyokuARAN-012ARAN012aran00012
    • 2020-12-21
    232 min

    [NSPS-956]My Beloved Wife Got Played With Like A Toy! Housewife Targeted By Strange Men...

  • arimura nozomi mizuki hayakawa censoredmature womandramaNSPSnagae stylejotaro tomiNSPS-956NSPS956nsps00956
    • 2020-12-27
    119 min

    [KSBJ-112]A Son's Wife Who Gets Her Father-in-law As A Sugar Daddy - Reina Aoi

  • aoi reina censoredcreampiebig titsKSBJksb kikaku emmanuelledirector oKSBJ-112KSBJ112ksbj00112
    • 2020-12-27
    120 min

    [AUKG-502]Me And My Classmate - Re: Matsuna & Chiharu - Lesbian S********ls Chiharu Sakurai Matsuna Koga

  • chiharu sakurai matsuna koga censoredschoolgirllesbianAUKGu krentoAUKG-502AUKG502aukg00502
    • 2021-01-09
    156 min

    [EBOD-797]Sparkling Like Snow - 20 Minutes Of Adultery At A Hotel With Your Busty, Lusty College S*****t Lover

  • censoredbig titsEBODe bodynaveEBOD-797EBOD797ebod00797
    • 2021-01-15
    63 min

    FC2PPV 1646203 [Urgent] Erotic Gal Nampa Man Creampie OK at the stakeout grind cowgirl against the opponent! Super dangerous tan bang bitch ♥ ass gal [personal shooting]

  • amateur uncensoredfc2
    • 2021-01-23
    46 min

    450OSST-007 The sober girl I found in Korea was a wasteful beauty with hidden big breasts and a beautiful look hidden with glasses! The self-proclaimed C cup and the hidden big breasts that lie modestly are good to massage! It’s okay to shake!

  • amateur censoredbig titsamateurosstosst-007osst007450osst-007
    • 2021-02-06
    179 min

    [NKKD-194]These Couples Missed The Last Train So They Spend The Night Together! - They Just Happened To Be Going In The Same Direction, But They End Up Sharing More Than Just A Taxi! 9

  • censoredbig titsNKKDjet eizomanji groupNKKD-194NKKD194nkkd00194
    • 2021-02-11
    225 min

    [PIYO-103]This S********l Had Such A Nice Personality And Was So Sensual That We Had Lovey-Dovey, Mind-Blowing Anal Sex!

  • censoredanalschoolgirlPIYOhyokopiero daPIYO-103PIYO1031piyo00103
    • 2021-02-12
    31 min

    [CLO-123]Cleavage Shots ... Her Bulging Big Tits Look So Naughty Underneath Her Clothes Haruka Koide

  • haruka koide censoredbig titsblowjobCLOchobitchchovicCLO-123CLO123h-1435clo00123
    • 2021-02-22
    145 min

    [NSPS-971]The Cuckold Fantasies The Wife Of A Sports Instructor Mao Kurata

  • kurata mao censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-971NSPS971nsps00971
    • 2021-02-23
    49 min

    FC2PPV 1698653 [Personal shooting] Sayuri 18 years old H cup is LJK. Creampie at the highest peak of big tits [Amateur video]

  • amateur uncensoredfc2
    • 2021-02-28
    85 min

    390JNT-017 [Runaway SEX Monster] SNS pick-up of a former bank clerk’s piano instructor who puts an erotic selfie on Lee ● Star! !! Squeeze sperm in a transcendent cowgirl trained on a dark trampoline! De M gal who loves Irama and strangling begs

  • amateur censoredcreampiebig titsjntjnt-017jnt017390jnt-017
    • 2021-03-11
    132 min

    [GUN-749]Vibrator Masturbation With Super Small Swimsuits

  • aki erie arai erie yuka osawa rumi tadami censoredsquirtingGUNradixshio sakurabaexceptionalGUN-749GUN749433gun00749
    • 2021-03-18
    92 min

    [GREDB-1023]Love Scandal/Mizuki Ozawa

  • censoredbig titsbeautiful girlGREDBintec incGREDB-1023GREDB1023h-706gredb01023
    • 2021-03-30
    41 min

    492JCHA-050 I Want A Woman To Call Me 6

  • amateur censoredschoolgirlamateurjchajcha-050jcha050492jcha-050
    • 2021-04-03
    120 min

    [NASH-485]Passionate Trip With My Stepmom: Family Fun In The Steamy Hot Springs - 6 Stories

  • censoredmilfmature womanNASHpinknadeshikoNASH-485NASH485nash00485
    • 2021-04-20
    240 min

    [TKBN-025]An Adultery Trip That Will Expose Their Lust Riko Honda Miki Sunohara Yuki Jin

  • honda future sunohara censoredTKBNstar paradisetreasure shipTKBN-025TKBN025h-254tkbn00025
    • 2021-05-22
    125 min

    [APAK-193]S********l Hot Spring Breeding "Breaking In A S*****t With Orgasms On An Overnight Trip..." Hana Himesaki

  • himesaki hana censoredcreampiebig titsAPAKaurora project annexrkAPAK-193APAK193apak00193
    • 2021-05-22
    123 min

    [AVSA-167]Slutty Girl With A Sexy Tongue AIKA

  • aika censoredslutsingle workAVSAavs collector sbuddha davscollector sAVSA-167AVSA167avsa00167
    • 2021-05-22
    61 min

    1Pondo 052221_001 Naughty Kiss and Fucking: Kana Takashima

  • amateur uncensored1pondo
    • 2021-06-04
    163 min

    [HODV-21578]Former Celebrity Debut - Oto Haruno

  • haruno oto censoredbig titssingle workHODVh m phimu lockHODV-21578HODV215785642hodv21578
    • 2021-06-05
    240 min

    [DSD-828]Glistening Slippery Oil Fuck!! 2

  • emma hick julie cash censoredbig titsDSDmomotaro video publishingmarchinsweetdevilDSD-828DSD828dsd00828
    • 2021-06-10
    85 min

    413INST-129 [Again, the voice actor world! ] LoveLa ● Bu! !! Photo session with an active idol 20 years old A ridiculous secret personal photo session that recorded a closed room hotel outflow, convulsions Iki thrust into a vibe pussy, and ahegao con

  • amateur censoredcreampieamateurinstinst-129inst129413inst-129
    • 2021-06-14
    90 min

    300MIUM-712 A Beautiful Girl Who Is Too Cute From Any View! !! The tide jet does not stop on the huge breasts that are about to spill. !! Have a look at SEX that you want to pass on to future generations! !! !! : Would you like to skip the company to

  • amateur censoredcreampiebig titsmiummium-712mium712300mium-712
    • 2021-06-16
    118 min

    [SSIS-094]I Had Sex With The Big Titty Married Woman Who Works At My Part-Time Job In A Restaurant Bathroom Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 styleinaballSSIS-094SSIS094ssis00094
    • 2021-07-08
    159 min

    [PIYO-120]The Day I Fell For My S*****t's Unsolicited Temptations...Days Living Together With A Big Tits S********l Who Ran Away From Home And Pleads For Creampies. Mei Satsuki

  • satsuki mei censoredcreampiebig titsPIYOhyokopiero daPIYO-120PIYO1201piyo00120
    • 2021-07-08
    123 min

    [DLDSS-017]The Queen of Kinshicho: The Hostess's Sexual Servicing of Customers Through Cum Swallowing and Creampies Ayaka Tomoda

  • ayaka tomoda censoredblowjobslutDLDSSdahliajounetsu yakaraDLDSS-017DLDSS0171dldss00017
    • 2021-07-10
    62 min

    383REIW-081 Riria

  • amateur censoredcreampieamateurreiwreiw-081reiw081383reiw-081
    • 2021-08-06
    80 min

    259LUXU-1469 Luxury TV 1440 Saffle Is Not Enough! An Active Race Queen With Slender Legs And Fascinating Big Eyes Is Here! I Smiled Happily At The Man’S Piston And Iki Many Times! Standing Back, Cowgirl, Missionary Position … This Beautiful

  • amateur censoredamateurluxuluxu-1469luxu1469259luxu-1469
    • 2021-08-06
    58 min

    230OREC-835 Hot Spring Slut Private College Student HRS

  • amateur censoredcreampieamateurorecorec-835orec835230orec-835
    • 2021-08-07
    91 min

    [ANX-136]A Strong Addiction To Being Not Quite Yourself: Her Territory - A New Area. Maina Yuuri.

  • yuuri censoredbig titscosplayANXsaimin kenkyuusho bekkansainansaimin rei onna saimin kenkyuusho bekkanANX-136ANX136anx00136
    • 2021-08-13
    120 min

    [SSIS-152]Testing The Theory That Even A College Girl Who Hates Old Dudes Will Come Like Crazy After Spending A Month Without Sex. Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsingle workSSISs1 no 1 styleasagiri jouSSIS-152SSIS152ssis00152
    • 2021-08-13
    208 min

    [HUNTB-080]She Was Bored With Normal Sex, And Wanted More Excitement, So She Decided To Take The Plunge Into Lesbian Love! But She Was Embarrassed, And Wasn"t Able To Take That Leap. So We Made A Suggestion, "It Won"t Be So Bad If A Cock

  • censoredcreampielesbianHUNTBhunterkonnyaku kannohhh groupHUNTB-080HUNTB080huntb00080
    • 2021-08-14
    94 min

    [VENX-067]While My Dad Was Away On A Company Vacation, I Spent The Entire Time Fucking My Stepmom, Whom I Had Always Adored, As We Spent Some Time Together In A Creampie Kind-Of Life Narumi Kawabata

  • narumi kawabata censoredcreampiemature womanVENXvenuskitano majimeincest vi nasuVENX-067VENX067venx00067
    • 2021-08-16
    152 min

    FC2PPV 2035326 Free Announcer Outflow * Limited Quantity *

  • amateur uncensoredfc2
    • 2021-08-26
    124 min

    [FSDSS-271]外出NGっつーからヤルことなくてヤリまくってたらこんなんなっちゃいましたけど！？ 永瀬みなも

  • minase nagase censoredFSDSSfalenokei isoifaleno starFSDSS-271FSDSS2711fsdss00271
    • 2021-09-09
    40 min

    361SEKAO-161 Unmin From South Korea

  • amateur censoredamateursekaosekao-161sekao161361sekao-161
    • 2021-10-08
    117 min

    [SSIS-199]This Blowjob-Loving Elder Sister Type Shed All Pretenses Of Being My Private Tutor And Kept On Sucking My Dick Because She Loves To See Me Moaning And Groaning With Pleasure Miharu Usa

  • miharu hanasaki censoredbig titsblowjobSSISs1 no 1 stylearashiyama michiruSSIS-199SSIS199ssis00199
    • 2021-10-12
    61 min

    Caribbeancom 101221-001 The Soul Of Actress: No Script More Excitement Than Usual Nana Kamiyama

  • nana kamiyama uncensoredcreampiecaribbeancom
    • 2021-10-12
    57 min

    Pacopacomama 101221_544 Even If She Got Older, She’s Still Driven Men Crazy

  • amateur uncensoredpacopacomama
    • 2021-10-21
    182 min

    [NHDTB-592]S******g With Boss"s Wife In Close Proximity To Him. Dominant Wife Has Beautiful Face Covered In Juice And A Wet Pussy.

  • censoredsquirtingdeepthroatNHDTBnatural highkansukeNHDTB-592NHDTB5921nhdtb00592
    • 2021-10-21
    68 min

    329EXMU-072 Marina-chan (Marina Saito)

  • amateur censoredcreampieschoolgirlexmuexmu-072exmu072exmu-072
    • 2021-10-25
    15 min

    FC2PPV 2371042 [First And Last Appearance, Limited Sale Of 300] Bg003 12 Shots In Total. A Large Amount Of Bukkake On A Tall 170 Cm SSS Class Beauty Louis Who Loves Semen. She Sticks Out Tongue And Waits For Semen.

  • amateur uncensoredfc2
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-30
    68 min

    200GANA-2586 Seriously Nampa, First Shot. 1709 It’s Super Cute Even If You Remove The Mask! Fair-Skinned And Slender Legs! If You Take Off Your Pants, It’s Smooth And Smooth! A Carnivorous Gal Aiming For One-Chan Is Pierced In The Vagina On

  • amateur censoredamateurganagana-2586gana2586200gana-2586
    • 2021-11-06
    145 min

    [SE-201]Good Morning C*cks! The Return Of The Amateur Hooker Creampie A Real-Life College Girl! Our Beloved, Beloved Sara Kagami A Sadistic, Silky Smooth (I Have A Shaved Pussy ...) Shitty Lady Boss Was Such A Super Selfish Bitch When It Came to Sex

  • censoredSEpuramutoukousha akirashirouto only plumSE-201SE20184se00201
    • 2021-11-14
    76 min

    345SIMM-676 [One Night And Two Days Staying Date Trip With J ○ And Ejaculation] Icharab Comfort Trip To A Hot Spring Town With My Favorite Uncle Away From The City! !! One Vaginal Cum Shot In A Yukata That Looks Great On A Big Pie! !! Bringing A Unif

  • amateur censoredcreampiebig titssimmsimm-676simm676345simm-676
    • 2021-11-19
    157 min

    [MISM-220]I Want To Develop My Anus More. I Want To Change The Pain To Pleasure. Anal Coming Out Please See The Real Me. I Soak In The Pleasure Crossing The Boundaries Of Presenting Your Three Holes. AV Actress Nissen Kanako"s Fetish Confession D

  • maika hizumi censoredanalbeautiful girlMISMemumusume labtakuanMISM-220MISM220mism00220
    • 2021-12-02
    64 min

    FC2PPV 2482631 Virgin Penetration Document "First Experience Is Forced Raw Saddle, It Feels Too Pleasant And Enters Love Love Mode. Creampie From Sweet Sexual Intercourse"

  • amateur uncensoredfc2
    • 2021-12-10
    118 min

    [IPX-778]Brainwashing - Submissive Therapy For A Popular Female Anchor To Make Her Body Totally Docile. Brainwashing Therapy, Bladder Control, Injecting For Squirting. Tough Female Anchor Finally Giving Into Indignity And Waves Of Pleasure. Kana Momo

  • kana momonogi censoredbig titsblowjobIPXidea pocketbungo maedadishIPX-778IPX778ipx00778
    • 2021-12-11
    69 min

    519MAZOF-028 [Ahegao Teacher Who Draws A Student] High School Japanese Language Teacher 26 Years Old [Libido Explosion] A Late-Blooming Female Teacher Who Does Not Know A Man, Is Kept By A De S Man And Apologizes To The Student With An Acme Addiction

  • amateur censoredcreampieamateurmazofmazof-028mazof028519mazof-028
    • 2021-12-14
    483 min

    [KTRA-358]10 Girls With Short Stature And Baby Faces, 8 Hours, 2 Discs

  • mie yazawa yukari miyazawa censoredKTRAk tribeKTRA-358KTRA358h-094ktra00358
    • 2021-12-28
    72 min

    FC2PPV 2550183 Loli Sui Cup! Two Vaginal Cum Shots On The Beautiful Huge Breasts Body Of The G Cup! !!

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored