housewife big tits censored jav creampie




FC2MIAAROYDSSISCJODAVSAWAAAHUNTBBLKNNPJEBODDASDAUKGNACRSANCAWDMEYDSPRDGVHADNDTT

2020-10-01
66 min

[NSSTH-059]A Married Woman Satomi I Turned The Boy Next Door Into One Of My Sex Toys Satomi Suzuki

  • satomi suzuki censoredsingle workdramaNSSTHnagae styleb saku sanonagae style short storyNSSTH-059NSSTH059nssth00059
    • 2020-10-10
    150 min

    [IPIT-006]"Please Get Me Off!" SEX CLIMAX Three-Fuck Special! The Blowjob Queen Part Two Emma Lawrence

  • emma lawrence censoredblowjobsingle workIPITidea pocketzaku araiideapocket talent discovery projectIPIT-006IPIT006ipit00006
    • 2020-10-24
    143 min

    [CAWD-128]Creampie Sugar Daddy: S*********ls In Uniform Become The Sexual Playthings Of Older Men - Suzu Nami

  • monami bell censoredcreampieuniformCAWDkawaiihiroyuki kimuraCAWD-128CAWD128cawd00128
    • 2020-10-30
    236 min

    [ASI-027]A Married Woman And Her First Time Shots 19 I'm About To Film A POV Video With This Married Woman

  • censoredbig titssquirtingASIprestigekanbiASI-027ASI027118asi00027
    • 2020-10-30
    115 min

    [PARATHD-3021]They Absolutely Shouldn't Be Into It... But They Are! Inside A 24-Hour Brothel Where The Hot Sluts Moan For More!

  • censoredbeautiful girlPARATHDparadise tvPARATHD-3021PARATHD3021parathd03021
    • 2020-11-06
    120 min

    [SSNI-911]This Elite Investigator Was Degraded With Aphrodisiacs And Turned Into A Golden Body Cum Bucket, Without Ever Taking Off Her Clothes Amu Hanamiya

  • hanamiya amu censoredbig titssingle workSSNIs1 no 1 styleichigoharaSSNI-911SSNI911ssni00911
    • 2020-11-06
    158 min

    [JBD-261]The Erotic Hell Of A Human Experimentation Battle A Mad Scientist Vs A Mad Psychologist Kanade Tsuchiya

  • kana tsuchiya censoredsquirtingdeepthroatJBDattackersusubashisuijabakuJBD-261JBD261jbd00261
    • 2020-11-12
    161 min

    [MIST-317]Ovulation Day Is Coming! A Soapland Where You Can Make Babies 24 - Rika Aimi

  • rumi tadami censoredbig titsbeautiful girlMISTmr michirusaitaMIST-317MIST3171mist00317
    • 2020-11-19
    237 min

    [HUNTA-893]"Damn Girl How Horny Are You...？!" My Coworker's Normally Not Sexy At All But After A Little Liquor Her Lust Is Off The Charts!

  • censoredcreampieHUNTAhuntercognac kaminohhh groupHUNTA-893HUNTA893hunta00893
    • 2020-12-12
    86 min

    FC2PPV 1603181 [Eh, a beautiful wife NTR pole who takes her body! I will expose it without a face w] When I forcibly invited the mother of the child actor, it was insanely erotic, so I made a vaginal cum shot and seeded NTR. I wonder if it’s a p

  • amateur uncensoredfc2
    • 2020-12-18
    46 min

    444KING-023 Aoi-san

  • amateur censoredcreampiemarried womankingking-023king023444king-023
    • 2021-01-08
    38 min

    359TYVM-120 Slender small breasts young wife super piss warp creampie sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-120tyvm120359tyvm-120
    • 2021-01-15
    120 min

    [UMSO-365]I Became A Divorcee Single Father When My Wife Ran Out On Me, But Suddenly I'm A Hot Item!？ The Neighborhood Mothers Were Sympathetic Towards Me, And Wanted To Help Out, So I've Been Committing Adultery With Them In The Afternoons v

  • censoredcreampiebig titsUMSOk m produceumanamiUMSO-365UMSO36584umso00365
    • 2021-01-22
    31 min

    359TYVM-124 Small Tits Sensitive Chikubi Wife Erotic Underwear Clothes Creampie Sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-124tyvm124359tyvm-124
    • 2021-01-26
    71 min

    [ant-008]つぐみん

  • amateur censoredamateurblowjobantant-008ant008ant-008
    • 2021-01-29
    48 min

    490FAN-093 Nao

  • amateur censoredbig titsamateurfanfan-093fan093490fan-093
    • 2021-01-30
    120 min

    [WAAA-031]Line Forms At Human Public Toilet - Creampies Welcome: 20 Deep And Hard Cumshots From Dirty Old Men In Large Orgy - Eimi Fukada

  • emi fukada censoredcreampiesingle workWAAAwanz factorywanzWAAA-031WAAA031waaa00031
    • 2021-02-01
    40 min

    FC2PPV 1668224 [No] Former Kano on a slope with fair legs. Creampie after flirting

  • amateur uncensoredfc2
    • 2021-02-09
    127 min

    [STARS-326]I Happened Upon My Girlfriend's Little Sister As She Came Out Of The Bathtub, And There She Was, Without Her Bra On, And I Couldn't Control My Erection, And When I Asked For Sex, She Bashfully Agreed, Because She Was Horny Too, And

  • hikari aozora censoredcreampiesingle workSTARSsod createeasy matsumotosod starSTARS-326STARS3261stars00326
    • 2021-02-25
    176 min

    [NHDTB-498]This Temp Worker Was Wearing An Outfit That Was Definitely Not Appropriate For The Office, Because It Fit Her Big Tits And Body Like A Glove And She Was Unwittingly Luring All The Men To Temptation, And She Was Begging To Be Fondled And Ca

  • censoredbig titssquirtingNHDTBnatural highhopeless dainanaNHDTB-498NHDTB4981nhdtb00498
    • 2021-02-28
    126 min

    [JJBB-005]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 05

  • censoredcreampiemature womanJJBBjukujo japanJJBB-005JJBB005jjbb00005
    • 2021-03-09
    482 min

    [MUCH-123]Colossal Tits! Big And Bouncy Maniacs 2 Sex With 10 Sluts 8 Hours 2 Video Set

  • megumi arina akatsuki minami censoredcreampiebig titsMUCHmothermuchi mutchiMUCH-123MUCH123h-796much00123
    • 2021-03-10
    189 min

    496SKIV-005 Jun-chan (26)

  • amateur censoredcreampieamateurskivskiv-005skiv005496skiv-005
    • 2021-03-18
    56 min

    [SIROR-054]The Work Of A Mature Woman For Rent - The Secret Side Of A Wife That Her Husband Will Never See - FILE NO.54

  • censoredcreampiebig titsSIRORdispatched.comSIROR-054SIROR054h-1492siror00054
    • 2021-03-29
    58 min

    [SHH-019]Seduced By A Massage Parlor Slut With My Wife Sitting Right Beside Me - She Climbed On Top Of My Cock And Rode It Slowly And Subtly Cowgirl Style Until I Gave Her A Creampie - Slender, Hot Booty Massage Parlor Domme

  • censoredslutSHHnatural highkansukeSHH-019SHH0191shh00019
    • 2021-04-20
    240 min

    [MGDN-151]Seducing And Fucking The Cleaning Woman 9 Women 4 Hours

  • censoreduniformmature womanMGDNstar paradisemegadonMGDN-151MGDN151h-254mgdn00151
    • 2021-04-23
    480 min

    [DRC-012]【期間限定販売】制服美少女個撮 8時間 03

  • amateur censoredbig titsuniformdrcdrc-012drc012drc-012
    • 2021-05-02
    29 min

    FC2PPV 1798612 [Post a real record! ] In exchange for a large reward, a vaginal cum shot! Realistic ● Dating movie! !!

  • amateur uncensoredfc2
    • 2021-05-13
    75 min

    326URF-062 [Back Customs x Libido Monster Banker] "Deliher is a vocation ♪" A neat and clean beauty who has a hobby of saving money in a hard profession is a customs part-time job to diverge SEX desire! It’s too unequaled and 4 shots are

  • amateur censoredcreampiebig titsurfurf-062urf062326urf-062
    • 2021-05-22
    96 min

    FC2PPV 1830409 Celebration! The 4th 1st Anniversary Appreciation Project! 2980PT → 1980PT [Beautiful wife NTR with no individual shooting, outflow, 〇Snow very similar] Called a beautiful mom model with SEX-less and cheating habit at work and conceive

  • amateur uncensoredfc2
    • 2021-05-25
    54 min

    FC2PPV 1835944 First shot ❤️ We will deliver from corner to corner of a Ubu woman who does not know the world yet [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-29
    96 min

    241GAREA-513 Miruka

  • amateur censoredamateurbeautiful girlgareagarea-513garea513241garea-513
    • 2021-06-10
    66 min

    FCP-022 [Delivery only] Absolutely subjective! !! Sperm is almost exhausted! Super feeling good! !! Nipple Licking Handjob ＃ 4

  • amateur censoredamateurbeautiful girlfcpfcp-022fcp022fcp-022
    • 2021-07-01
    60 min

    Pacopacomama 070121_497 Secret with the wife next door Reiko Shibata

  • amateur uncensoredpacopacomama
    • 2021-07-10
    116 min

    [NSFS-007]Mature Stepmother 12 ~ The Stepson Who Loved His Stepmother ~ Yuri Tadokoro

  • yuri tadokoro censoredmature womanmomNSFSnagae stylejotaro tomiNSFS-007NSFS007nsfs00007
    • 2021-07-10
    130 min

    [AVSA-172]SUPER FISHEYE FETISHISM Voluptuous Nympho Nurse's Thick Curves Honami Akagi

  • honami akagi censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-172AVSA172avsa00172
    • 2021-08-06
    137 min

    [MUDR-156]Ever Since That Day ... Breaking In A Beautiful Y********l In Uniform With Creampie S&M Training Minami Hatsukawa

  • hatsukawa minami censoredcreampieschoolgirlMUDRmukuMUDR-156MUDR156mudr00156
    • 2021-08-07
    127 min

    [CEMD-043]Non-Stop Tear-Filled Wild Orgasmic SEX, No. 12. Rin Miyazaki.

  • miyazaki rin censoredmature womansingle workCEMDserebu no tomoCEMD-043CEMD043cemd00043
    • 2021-08-16
    56 min

    230OREC-861 Bunny H

  • amateur censoredcreampieamateurorecorec-861orec861230orec-861
    • 2021-09-09
    95 min

    240TOKYO-429 Ayumi

  • amateur censoredamateurcosplaytokyotokyo-429tokyo429240tokyo-429
    • 2021-10-06
    76 min

    476MLA-052 3p First Experience While Shiroto Girls Are Bewildered! Peeing With A Neat Appearance! !! Facial Cum Shot And Vaginal Cum Shot That A Sensitive Busty Beauty Member Received In Exchange For A Large Reward

  • amateur censoredcreampiebig titsmlamla-052mla052476mla-052
    • 2021-10-08
    60 min

    FC2PPV 2314672 * Until 10/10 3980⇒2980 ★ First Shot ☆ 147cm Mini Small Breasts Loli Body ♥ Cute Bishoujo Harupyon 18 Years Old ☆ Excellent Sensitivity! Geki Iki Squirting Pussy ♥ Big Cock Is Thrust Into A Small Body And Faint In Agony Iki Rolled Vagi

  • amateur uncensoredfc2
    • 2021-10-11
    59 min

    [SHH-028]Cheating With My Wife Right There. Massage Parlor Offering A Calming Massage While Taking His Dick In For Ass Shaking Cowgirl And A Creampie Load For A Neat And Clean, But Secretly Lewd Gorgeous Esthetician.

  • censoredslutSHHnatural highkansukeSHH-028SHH0281shh00028
    • 2021-10-21
    123 min

    [FSDSS-343]Fresh Face Practically A Virgin But Strongly Curious About Sex Mayu Horizawa AV Debut

  • mayu horizawa censoredbig titsblowjobFSDSSfalenomaeda tomonorifaleno starFSDSS-343FSDSS3431fsdss00343
    • 2021-10-25
    53 min

    274DHT-0319 Other Stick (Mom’s Friend’s Husband) Tasting Party! ？？ Shameless Orgy By Exchanging A Sleeping Couple! !!

  • amateur censoredcreampiebig titsdhtdht-0319dht0319274dht-0319
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-02
    74 min

    374IMGN-029 AYAME (23) (Ayame Kinoshita)

  • amateur censoredmarried womanamateurimgnimgn-029imgn029374imgn-029
    • 2021-11-06
    162 min

    [DNJR-062]Rika Tsubaki"s Dirty Talk, Teasing a Masochistic Male

  • tsubaki rika censoredbig titsslutDNJRinu mousozokumaboroshi koDNJR-062DNJR062dnjr00062
    • 2021-11-20
    138 min

    [CEMD-089]Wet Anal SEX! Akari Niimura ~Cumming So Many Times With Booze And Anal!

  • akari shinmura censoredanalbig titsCEMDceleb no tomoCEMD-089CEMD089cemd00089
    • 2021-11-21
    49 min

    230OREC-942 Kiu (Aihara Tsukiha)

  • amateur censoredcreampieuniformorecorec-942orec942230orec-942
    • 2021-11-28
    63 min

    300NTK-666 [Fair-Skinned x Beautiful Busty x Nasty = Winner Echona Beauty! !! ] [Seriously Koi Men’s Miss S Blow] [Accident Sumata Raw Insertion! !! ] Jiji Chingachi Koi No Healthy Men’s Esthetic (With Nuki Ww) A Whitening Busty Beauty With

  • amateur censoredcreampiebig titsntkntk-666ntk666300ntk-666
    • 2021-12-17
    120 min

    [MIAA-550]My Former Classmate Is A Tanned Gal Who Used To Bully Me, But Now, To My Surprise, She Has Become My Big Sister-In-Law! Since She"s No Longer Satisfied With Her Husband, This Bitch Has Taken To Tweaking My Nipples And Teasing Me To Deat

  • ranka censoredcreampieblowjobMIAAmoody scaptain gangwoneveryone s kikatanMIAA-550MIAA550miaa00550
    • 2022-01-08
    198 min

    [TPIN-022]Risky Peeping, Limited To Girls Living Alone. Peeping Into An Apartment. 4 Rooms. 3 Hours, 18 Minutes.

  • censoredcreampieamateurTPINchinpoinTPIN-022TPIN022tpin00022
    • 2022-01-25
    71 min

    FC2PPV 2622147 [Personal Shooting] 18-Year-Old Child-Bearing Too Erotic Young Wife And Sexy Maid Costume Super-Dense Raw Vaginal Cum Shot Copulation !! Married Woman: Yuki (18 Years Old)

  • amateur uncensoredfc2
    • 2022-01-28
    156 min

    [MIDV-038]新人18才 オッパイは少女中身は子供Gカップ 性の知識はちょっとだけ無自覚AVデビュー 佐久良咲希

  • sakura saki censoredbig titsbeautiful girlMIDVmoodyzmichiru arashiyamamoodyz divaMIDV-038MIDV038midv00038
    • 2022-01-28
    59 min

    [WKD-050]Record Of Sex During A Secret Meeting With An Adulterous Married Woman. Ayane Sezaki.

  • ayane sezaki censoredbig titsslutWKDwaap entertainmentk westwWKD-050WKD0502wkd00050



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored