housewife censored amateur virgin javcensored




FC2MIDVAPODBBANGMEMLULUBLKHNDMARASQTESSNIHDKACHRVAWDNATRDTTNACXATIDABWSDABROYD

2020-09-11
96 min

FC2PPV 1499339 [God times 3P] 3 shots in a row (2 consecutive vaginal cum shot ❤ Cum x 1) [Appearance] Immoral natural big tits F cup wife cuckold ❤ 2 stranger sticks Falling unfaithful wife w G sports Gakuburu cum every time it is struck! Rich vagin

  • amateur uncensoredfc2
    • 2020-09-12
    240 min

    [FONE-119]Shocking! Striking! Footage Of Real Virgins Losing Their Virginity One Time AV Appearance 4 Hours

  • censoredamateurbeautiful girlFONEfirst starplus first starFONE-119FONE119h-491fone00119
    • 2020-09-13
    126 min

    [USAG-020]Creampie Fucking A Naive College Girl Who Turned Out To Be A Hidden Masochist Pervert - Haruka (22)

  • censoredcreampiebeautiful girlUSAGrabbit daydreamersUSAG-020USAG020usag00020
    • 2020-09-19
    59 min

    1Pondo 091920_001 The neighbor is…! NTR unforgettable ex-boyfriend cock Mika Sumire

  • amateur uncensored1pondo
    • 2020-09-21
    121 min

    [AVSA-140]Perverted Slut Group Fuck Sex Object Yuri Sasahara

  • yuri sasahara censoredblowjobmature womanAVSAavs collector sbuddha davscollector sAVSA-140AVSA140avsa00140
    • 2020-10-15
    89 min

    [FUGA-043]Steamy Sex With My MILF's Best Friend Sakiko Narumiya

  • narumiya sakiko censoredcreampiemature womanFUGAcenter villageminatoyarakuenFUGA-043FUGA043h-086fuga00043
    • 2020-10-16
    240 min

    [MBM-221]mpo.jp Presents The Nonfiction Amateur Documentary Divine Best Hits Collection (Exquisite Big Tits Jiggling And Wiggling Powerful Sex Edition) 12 Ladies 4 Hours

  • censoredcreampiebig titsMBMprestigempo selection.committeembmMBM-221MBM221118mbm00221
    • 2020-10-22
    60 min

    1Pondo 102220_001 Let Me Fuck Your Wife : Yuka Sayama

  • amateur uncensored1pondo
    • 2020-10-24
    116 min

    [CAWD-127]My Mean Slutty Junior's Handjob I Can't Resist It Even For 1 Minute - Moko Sakura

  • sakura moko censoredcreampiebeautiful girlCAWDkawaiiamazing meatCAWD-127CAWD127cawd00127
    • 2020-10-25
    52 min

    330PER-332 Mitsuha 2

  • amateur censoredamateurcosplayperper-332per332330per-332
    • 2020-11-06
    125 min

    [SSNI-904]Saki Okuda: 2 Hours Till The Last Train Comes, Having Adulterous Sex With My Irreplacable Mistress With The Hottest Proportions

  • saki okuda censoredbig titsblowjobSSNIs1 no 1 styleelorchoSSNI-904SSNI904ssni00904
    • 2020-11-06
    115 min

    [PARATHD-3034]Smoking Hot Former Bad Girl Divorcee Nurse Is So Fuckable I've Got To Try It

  • censoredcreampieamateurPARATHDparadise tvPARATHD-3034PARATHD3034parathd03034
    • 2020-11-15
    106 min

    300MIUM-648 [Women who are too comfortable to hold] Rent a certain dream country cast as her who loves a smiling face too much! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoyi

  • amateur censoredbig titsamateurmiummium-648mium648300mium-648
    • 2020-11-19
    118 min

    [PPPD-884]My C***dhood Friend With Big G-Cup Tits Became A Callgirl Known For Her Great Titty Fucks - Now We're Going To Live Together For 3 Days, No Restrictions On Cumming! Nene Tanaka

  • nene tanaka censoredcreampiebig titsPPPDoppaiPPPD-884PPPD884pppd00884
    • 2020-11-30
    72 min

    345SIMM-563 A super beautiful new employee who exudes a graceful lady feeling is drunk and squid with a boss stick! Tipsy SEX of boss x subordinates!

  • amateur censoredcreampieamateursimmsimm-563simm563345simm-563
    • 2020-12-03
    479 min

    [CADV-794]Crystal Films 35th Anniversary - Triple Lesbian 8-Hour Special

  • yuki misa ayako kano censoredsquirtinglesbianCADVcrystal picturecrystal exCADV-794CADV79449cadv00794
    • 2020-12-12
    63 min

    [HHKL-077]Hey Big Stepbrother, Let's Have Lots And Lots Of Sex Before Our Stepmom And Stepdad Cum Home! A Little Stepsister Who Wants To Get Fucked By Her Big Stepbrother, And A Big Stepbrother Who Wants To Fuck His Little Stepsister Their Steppa

  • mizuki yayoi censoredcreampiesisterHHKLhuntervolvo nakanohhh groupHHKL-077HHKL077hhkl00077
    • 2020-12-17
    153 min

    [SSNI-939]Teased To Your Limit - Edging And Aphrodisiac Orgasms - The Ultimate Pleasure Yua Mikami

  • yua mikami censoredbig titssquirtingSSNIs1 no 1 stylekyoseiSSNI-939SSNI939ssni00939
    • 2020-12-18
    36 min

    359TYVM-114 Kaori

  • amateur censoredcreampiemarried womantyvmtyvm-114tyvm114359tyvm-114
    • 2020-12-18
    34 min

    [BTH-099]Raw Group Sex Girl - Kana Morisawa

  • kana morisawa kanako iioka censoredcreampieblowjobBTHchobitchchovicBTH-099BTH099h-1435bth00099
    • 2020-12-25
    54 min

    [oretd-818]りかさん

  • amateur censoredcreampieamateuroretdoretd-818oretd818oretd-818
    • 2021-01-07
    92 min

    AVKH-189 Shiori Sawada

  • amateur censoredbig titsamateuravkhavkh-189avkh189avkh-189
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-26
    124 min

    [SCPX-416]The Beautiful Girl Next Door Had A Fight With Her Boyfriend And Stormed Out Of The House In Her Underclothes. "It's Cold, Why Don't You Come In？" I Told Her, And Invited Her Into My Room, But When I Saw Her So Defenseless, W

  • censoredcreampiebig titsSCPXk m producehasshiscoop kmpSCPX-416SCPX416h-565scpx00416
    • 2021-02-20
    120 min

    [NXG-360]Would You Like To Work A Part-Time Job？ We Propositioned This Elder Sister Type "We Absolutely Won't Ever Lay A Finger On You!! And We'll Pay You If You'll Hear Out Our Erotic Requests Please!!"

  • censoredamateurblowjobNXGstar paradisenext groupNXG-360NXG360h-254nxg00360
    • 2021-04-09
    62 min

    FC2PPV 1761680 [None / Piece] Lori-based huge breasts chubby student Yui-chan and gym clothes ♪ * High-quality review benefits available

  • amateur uncensoredfc2
    • 2021-04-30
    83 min

    374IMGN-009 Kozue

  • amateur censoredcreampieamateurimgnimgn-009imgn009374imgn-009
    • 2021-05-02
    133 min

    [MKON-051]The Story Of How My Beloved Girlfriend Cheated With Her Pushy, Athletic Boss Hinako Mori

  • hinako mori censoredcreampiecosplayMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-051MKON051mkon00051
    • 2021-06-25
    210 min

    [JUFE-303]To Ai-chan... Thank You For Making Me Feel Better By Fucking My Brains Out After My Girlfriend Dumped Me Ai Mukai

  • ai mukai censoredcreampieslutJUFEfitchsamoariJUFE-303JUFE303jufe00303
    • 2021-06-29
    140 min

    [SDAB-185]It's 7 Hours Remaining Until Curfew Time, And This Beautiful Girl With An Exquisite Body Is Surrounded By 9 Creepy Crawly Dirty Old Man Cocks, Relentlessly Creeping On Her In A Long Day Of G*******g Sex Saya Kuriyama

  • saya kuriyama censoredbeautiful girlsingle workSDABsod createharii ichiseishun jidaiSDAB-185SDAB1851sdab00185
    • 2021-07-09
    42 min

    FC2PPV 1912367 ♡ Pure white Lori angel ♡ [One de M beautiful girl in 100 years! !! ] Idol Center Class FC2 I tried to make a vaginal cum shot to the legendary goddess (* ´ ▽ ｀ *) ♡ No ♡ [Early end available! ]

  • amateur uncensoredfc2
    • 2021-07-11
    115 min

    [083PPP-2181]俺の家政婦ミナミさん(3)

  • amateur censoredamateurcosplaypppppp-2181ppp2181083ppp-2181
    • 2021-07-15
    95 min

    [AKDL-126]"Don't Put It In!" You Promised...Inserting It Raw Into The Moist Vagina Between Her Things I Fuck My Best Friend's Adorable Girlfriend Rua Takashiki

  • takashiki censoredcreampiedramaAKDLaquinoriaquinoriaknrAKDL-126AKDL1261akdl00126
    • 2021-07-15
    47 min

    481SACZ-045 Chika 3

  • amateur censoredamateurbdsmsaczsacz-045sacz045481sacz-045
    • 2021-07-22
    107 min

    [HTHD-188]My Friend's Mother - Last Chapter - Rio Ohara

  • osamu osamu censoredcreampiemature womanHTHDcenter villagejiro fukagawahona zonoHTHD-188HTHD188h-086hthd00188
    • 2021-07-22
    118 min

    [MIDE-958]Strong-Willed Female Boss Regains The Pussy Of Her Youth When She Wears A School Uniform For The First Time In 10 Years! A Stud Like Me Was More Than Happy To Fuck Her All Night! Mizuki Aiga

  • mizuki ai censoredcreampieuniformMIDEmoodyzzaku araimoodyz divaMIDE-958MIDE958mide00958
    • 2021-08-12
    114 min

    [IENF-159]I"m A Loser, But My Big Tits Big Sister Said, "I"ll Let You Rub Your Cock Up Against Me," And Made Me Promise Only To Grind, But We Both Started To Feel So Good, And Her Pussy Was Dripping Wet, So My Dick Just Slipped Right

  • tsukishima sakura hanamiya amu censoredcreampiebig titsIENFie nergyienfIENF-159IENF1591ienf00159
    • 2021-09-09
    93 min

    [OKS-119]Luna Tsukino. Wet Glistening School Swimsuit That Clings To Her. A Cute Girl In A Dripping Wet School Swimsuit Is The Best! Starting With An Outfit Change While Peeping, Small Tits To Big Tits, Shaved Pussy, Pussy Hair Sticking Out, Armpits

  • tsukino luna censoredschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-119OKS1191oks00119
    • 2021-09-11
    139 min

    [BEFG-004]Teasing Temptress Queen Violation Hell Episode: Extremely Hot! Sadistic Beautiful Girl From A Secret Society. Ichika Matsumoto

  • ichika matsumoto censoredschoolgirlbdsmBEFGbaby entertainmentkikubongolden babeBEFG-004BEFG004befg00004
    • 2021-10-10
    63 min

    300NTK-645 [Underground Idols #God Body #Tall G Breasts And Individual Shooting In Love Hotel! !! ] G Milk Glamorous God Body Hissage Love Hotel Individual Shooting! !! It Should Be Strictly Prohibited To Touch … Immediate Squirting From The Lif

  • ssrgsex censoredcreampiebig titsntkntk-645ntk645300ntk-645
    • 2021-10-23
    70 min

    300NTK-654 [Halloween Excitement With Kos H Of The Finest Beauty Bombing A Big Problem Of A Big Orgy Without Rubber! ？？ ] The Bottomless Libido Release That Is Not Afraid Of The God Of Bakujiri Gal! !! Continuous Squeezing Pursuit Sex By Making Full

  • amateur censoredcreampieamateurntkntk-654ntk654300ntk-654
    • 2021-10-27
    53 min

    [ETQR-298][Daydream POV] Mai, A Receptionist Who Wants To Be Fucked

  • censoredcreampieuniformETQRerotic timeETQR-298ETQR298etqr00298
    • 2021-10-28
    112 min

    [AARM-030]Mahiro Ichiki, An Antisocial Reclusive Novelist Without A Boyfriend, Uses Her Slender Beautiful Legs To Charm And Pleasure Men To Get Material For Her Erotic Novel.

  • mahiro ichiki censoredsingle workAARMaroma kikakuhamu oujiaromaAARM-030AARM030aarm00030
    • 2021-11-19
    120 min

    [SSIS-255]Former Idol Riko Kasumi - First Orgasm Three Full Fucks

  • kasumi riko censoredsingle workSSISs1 no 1 stylearashiyama michiruSSIS-255SSIS255ssis00255
    • 2021-11-20
    133 min

    [AVSA-185]Unparalleled Big Tits Crazy Lust Circle Nanami Matsumoto

  • nana matsumoto censoredbig titssingle workAVSAbuddha dAVSA-185AVSA185avsa00185
    • 2021-11-25
    140 min

    [KMHRS-058]超絶敏感マ〇コにチ〇コ生ハメ→失神するほど絶頂

  • ikuta machi censoredcreampieKMHRSinoue japaninoue japansod createKMHRS-058KMHRS058
    • 2021-12-03
    120 min

    [MIAA-541]She Hated Her Boss, But His C*ck Simply Hit The Spot, Way Too Well ... And After He Made Her Cum So Hard She Could Die, They Hungered For Each Other With Second Helping Creampie Sex Yumeru Kotoishi

  • yume kotoishi censoredcreampieblowjobMIAAmoody smamezawa mametaroeveryone s kikatanMIAA-541MIAA541miaa00541
    • 2021-12-10
    118 min

    [JUL-792]The Never-ending Days Of Nakadashi-wa... Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-792JUL792jul00792
    • 2021-12-13
    54 min

    544IDJS-080 Anju (25) [Female Anna Style Beauty] [Super Beautiful Legs] [Creampie]

  • amateur censoredcreampieamateuridjsidjs-080idjs080544idjs-080
    • 2021-12-14
    62 min

    Pacopacomama 121421_571 A Mature Woman With Only Excuses Has Outstanding Sensitivity! Rina Shirakawa

  • amateur uncensoredpacopacomama
    • 2021-12-20
    180 min

    [OFKU-194]I Was Able To Have Condomless Sex With My Beautiful Mother-In-Law, Who Is Sexier Than My Wife.

  • megumi isoyama satomi fueki censoredcreampiebig titsOFKUstar paradisemom railOFKU-194OFKU194h-254ofku00194
    • 2021-12-21
    69 min

    200GANA-2606 Sex Hidden Camera Brought In In The Spear Room Of A Nampa Master Of Hyakusen Renma 230 Sex By Persuading A Fair-Skinned Slender Beautiful Girl Who Brought Home! Hidden Camera To Voyeur The Whole Story! She Loves Service And Wants To Lick

  • amateur censoredamateurganagana-2606gana2606200gana-2606
    • 2021-12-24
    118 min

    [ROE-032]On The Eve Of Her Son"s Marriage, The Mother Became A Woman. Yuka Mizuno

  • yuka mizuno censoredmature womanmomROEmadonnaamazing meatmonroeROE-032ROE032roe00032
    • 2021-12-31
    34 min

    FC2PPV 2553598 First Shot! !! Limited Number! [Uncensored] Love Juice That Overflows Every Time It Is Struck, A Lewd Voice And A Gaze … Creampie Twice To A Beautiful Ecup Beauty With A Korean Wave Half! !! It Was Horny With Clear And Beautiful S

  • amateur uncensoredfc2
    • 2022-01-14
    93 min

    300MIUM-760 Yariman Neat Gal! !! !! [Mutchimuchi’s Extreme Erotic Body! !! ] × [Saffle Over 100 People! A Miracle Unequaled Gal Who Has Sex Up To 20 Times A Day ★] × [Licking From The Nipple To The Back Of The Ball With A Tongue! !! ] Iki Tide D

  • amateur censoredcreampieamateurmiummium-760mium760300mium-760
    • 2022-01-29
    115 min

    [XVSR-634]The Whole Story Of Perverted Spouse-Cheating Play Due To An Abnormal Couple. Hibiki Otsuki

  • otsuki sound censoredcreampieslutXVSRmax asono kancalenXVSR-634XVSR634xvsr00634



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored