housewife censored high vision hours more jav




FC2VENUAMBINACXAPODAUKGSANDASDGMEMPPPDEBODLULUAUKGHNDSTARSMILKAVSASQTECHRVMEYDSHKD

2020-11-27
86 min

[KIRM-001]-Deep Oral Penetration- Nagi Miyoshi

  • miyoshi nagi censoredKIRMsanji s side dishdeep throatingsanji s side dish poleKIRM-001KIRM001h-1540kirm00001
    • 2020-12-05
    118 min

    [SSNI-930]My Club's Busty Female Manager Offered To Let Me Lose My Virginity And Wound Up Cumming Hard On My Cock Miharu Usa

  • miharu hanasaki censoredbig titsbeautiful girlSSNIs1 no 1 styleusa pyonSSNI-930SSNI930ssni00930
    • 2020-12-05
    87 min

    FC2PPV 1594898 [First appearance 1st place God Fcup beauty witch It is the third of another married woman. ] First stay secret meeting NTR 2nd round! I loved the beautiful witch who fell into an affair all night, but started M training. It’s apt

  • amateur uncensoredfc2
    • 2020-12-18
    35 min

    [BTH-098]My Evil Wife Is Cold Towards Me, But In That World, It Seems That She's A Highly Rated Bitch Who's Good For Breaking In. Miwako Yamamoto

  • yamamoto miwako censoredblowjobsingle workBTHchobitchsuper bitchBTH-098BTH098h-1435bth00098
    • 2021-01-04
    123 min

    [C-2605]When We Installed A Camera Inside An Adult Video Manufacturer's Employee Dormitory, This Is What We Got!! 02

  • censoredCgogosgogo s coreC-2605C2605140c02605
    • 2021-01-08
    240 min

    [SVDVD-834]The Magic Mirror Number Bus Hard Boiled What's In The Box？ If You Can Identify 3 Barely Legal Summer Girl Exhibitionist Babes Who Like To Show Off Their Skin, You Win 100,000 Yen! Take The Quiz Challenge!! She's Secretly Squeezing

  • censoredcreampiesquirtingSVDVDsadistic villagenew kage kazamamagic mirror number sadistic villageSVDVD-834SVDVD8341svdvd00834
    • 2021-01-15
    61 min

    FC2PPV 1638282 [Uniform Gonzo] Rui ☆ Special price ♪ Black hair twinte × uniform is a combination of royal roads ☆ Of course I will not take it off naked until the end (basic of cosplay etch) ★ Geki Saddle demon thrust [Review special

  • amateur uncensoredfc2
    • 2021-01-15
    131 min

    [SKEJ-005]The Second Love Of Her Life!! Married Woman Falls For Pleasure - Ren

  • censoredmarried womanSKEJamateur time delusion groupSKEJ-005SKEJ005skej00005
    • 2021-01-22
    240 min

    [MBM-266]mpo.jp Presents The Nonfiction Amateur Nampa Seductions Divine Best Hits Collection (Time-Saving Quickie Fucks Featuring Prematurely Ejaculating Ladies) 12 Ladies 4 Hours

  • censoredsquirtingamateurMBMprestigempo selection.committeembmMBM-266MBM266118mbm00266
    • 2021-01-29
    46 min

    490FAN-086 Sara

  • amateur censoredbig titsamateurfanfan-086fan086490fan-086
    • 2021-02-01
    71 min

    [HKHS-010]Picking Up Girls In L.A.: Slender Body, Beautiful Legs And A Great Ass - Be Impressed By Her Wonderful Leg Techniques - Nora, 28

  • censoredcreampieamateurHKHShikara delusion grouphollywood saburoHKHS-010HKHS010hkhs00010
    • 2021-02-04
    90 min

    [MESU-082]I Asked For The Number One Bubble Princess At A High Class Bathhouse, And To My Surprise, Out Came This Old Lady!？ But 2 Hours Later, I Was Sucked Dry To The Bone... This Is What It Means To Experience The Legendary Fully Ripe Creampie Bath

  • yumiko sakura censoredcreampiemature womanMESUcenter villageshibuyared snowMESU-082MESU082h-086mesu00082
    • 2021-02-06
    31 min

    FC2PPV 1675445 Limited to 3 days [Individual] Beautiful wife of a spender. She can not repay and is taken to the room and vaginal cum shot in her raw vagina

  • amateur uncensoredfc2
    • 2021-02-06
    84 min

    383REIW-041 Aya

  • amateur censoredcreampieamateurreiwreiw-041reiw041383reiw-041
    • 2021-02-19
    232 min

    [DOCP-274]"No, No, No! Your Dick Is Inside Me! You Made A Promise To Only Rub Your Cock Against My Pussy ...!" Your Little Stepsister Has Grown To Become A Fine Young Woman, And Now You're Lusting For Her! She May Say One Thing, But Her P

  • yuri fukada mai takeda censoredcreampiebig titsDOCPprestigedoc premiumDOCP-274DOCP274118docp00274
    • 2021-02-27
    160 min

    [WAAA-035]My Big Sister-In-Law Hates My Guts, But I Just Happened To Run Into Her, Working At A Soapland. And Now I Can Have All The Sex I Want, And I'm Going To Make Her Service Me In Style And Creampie Fuck Her, Over And Over Again! Honoka Tsuj

  • tsujii honoka censoredcreampiebig titsWAAAwanz factorywanzWAAA-035WAAA035waaa00035
    • 2021-04-02
    145 min

    [JBD-265]S********l Snake Tied - G*******g 14 Erena Takeda

  • elena takeda censoreduniformsingle workJBDattackershana kanojabakuJBD-265JBD265jbd00265
    • 2021-04-08
    24 min

    HEYZO 2495 Marina’s Orgasms with Toys – Marina Hasumi

  • marina hasumi uncensoredheyzo
    • 2021-04-13
    138 min

    [KUSE-013]No Way I'd Ever Fuck Him! The Rookie Female Teacher In Charge Of The Swim Team Gets Slipped An Aphrodisiac To Make Her Horny For The Principal She Hates Yota Chan

  • chanyota censoredsingle workdramaKUSEsod createryo inugamithis actress style is amazingKUSE-013KUSE0131kuse00013
    • 2021-05-01
    240 min

    [HUNTB-001]"What!？ Really, You Want Me To Fuck You？" She's After My Cherry Boy Cock!？ The Class S*****t Council President Seemed Like A Hard Nut To Crack, But It Turns Out She's A Prim And Proper Slutty Bitch Who Loves To Fuck Cherry

  • censoredcreampieHUNTBhuntervolvo nakanohhh groupHUNTB-001HUNTB001huntb00001
    • 2021-05-01
    63 min

    SIRO-4505 [First shot] [Innocent girl] [Natural H cup daughter] A shy and pure active college student participates in the war. While she was listening to the story, she was attracted to her charm and took off her cute clothes .. AV application on the

  • amateur censoredbig titsamateursirosiro-4505siro4505siro-4505
    • 2021-05-01
    120 min

    [NACR-418]I Was Domesticated By My Father-In-Law Natsu Tojo

  • natsu tojo censoredcreampiesquirtingNACRplanet plusbito sakurananakuruNACR-418NACR418h-237nacr00418
    • 2021-05-01
    171 min

    [NKKD-208]This Is The Story Of How My Wife (28 Years Old) Got Fucked By A Part-Time Worker (20 Years Old, And A Cherry Boy) At Her Part-Time Job ... And I'm So Frustrated That I'd Like To Sell This Footage As An Adult Video (The Hunting Cherr

  • censoredslutNKKDjet eizomanji groupNKKD-208NKKD208nkkd00208
    • 2021-05-02
    149 min

    [DNJR-050]She Wants To Domme And I Want To Be Dominated. I Was Suddenly Transferred To My Company's Lingerie Division And Seeing Me So Flustered Awakened My Coworker's BDSM Instincts - She Started Hitting On Me At Work Under The Guise Of &quo

  • inaba chiaki uehara censoredbig titsslutDNJRdog daydreamersmaboroshikoDNJR-050DNJR050dnjr00050
    • 2021-05-04
    134 min

    [KIRE-036]This Lady Boss Is Getting Horny And Dripping Wet, Sucking Your Young Employees' Cocks In The Middle Of The Day. This 46-Year Old Married Woman Has Been Neglected By Her Husband So She's Hooked On Adultery Sex With Her Male Employees

  • grace narisaki censoredbig titssingle workKIREsod createyosukebeauty kirei sodKIRE-036KIRE0361kire00036
    • 2021-06-01
    38 min

    475SKCK-035 Himena 3

  • amateur censoredanalamateurskckskck-035skck035475skck-035
    • 2021-06-08
    45 min

    H0930 ki210608 Kana Iwamoto 45years old

  • amateur uncensoredh0930
    • 2021-06-12
    159 min

    [NASH-516]The Fun Of a Man In His 50s: A Rare Unfaithful Housewife. Aah, I Want To Have Sex With A Man... Document Of The Falsehoods Of 6 50-something WIves

  • censoredcreampiebig titsNASHnadeshikoshigeru hagaNASH-516NASH516nash00516
    • 2021-07-02
    174 min

    [RBK-018]At The End Of A Nasty Revenge Confinement And Breaking In... Kana Morisawa

  • kana morisawa kanako iioka censoredsingle workRBKattackersusubashisuiryupakuRBK-018RBK018rbk00018
    • 2021-07-31
    151 min

    [KTB-049]The Fresh OL Club! Ichika Ichika Matsumoto

  • ichika matsumoto censoredschoolgirlsingle workKTBkahanshin tigers mousozokukahanshin tigersKTB-049KTB049ktb00049
    • 2021-08-01
    122 min

    [NACR-443]Beautiful Tipsy Wife From Next Door "I"m home!" Miho Tono

  • miho tsuno censoredcreampieslutNACRplanet plusdirector oshichi ku ryuuNACR-443NACR443h-237nacr00443
    • 2021-08-07
    140 min

    [MMNT-010]派手そうに見えるけど実は人見知り… SEX偏差値MAXギャルがAvdebut 寺田ここの

  • terada here censoredbig titssquirtingMMNTk m producekaorumillion mint mirionmintoMMNT-010MMNT010mmnt00010
    • 2021-08-07
    120 min

    [MDTM-737]I Was Booked Into The Same Hotel Room As My Excessively Cute Colleague, So We Had Adultery Sex That Night After The Company Party Until The Break Of Dawn. Rin Kira

  • kira rin censoredcreampiesingle workMDTMk m producetodouchuu kikakuMDTM-737MDTM737mdtm00737
    • 2021-08-31
    75 min

    326KNTR-005 [NTR] Masochist Desire I’M Crazy With Distorted Love … ~ The Neat And Clean Girlfriend I Met At The University Fell Into A Female At The End Of Jealousy And Wanted A Vaginal Cum Shot Sexual Intercourse ~

  • amateur censoredcreampieamateurkntrkntr-005kntr005326kntr-005
    • 2021-09-03
    79 min

    230OREC-869 Kokona

  • amateur censoredcreampiebig titsorecorec-869orec869230orec-869
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-17
    124 min

    [FOCS-019](Complete POV) Horny Girlfriend That Loves Dirty Talk While Squeezing All That Cum Out! This Innocent Looking Girl With A Kansai Accent Secretly Loves To Fuck! Nonstop Creampie With Tons Of Cum Overflowing From Her Pussy. Mikako Horiuchi

  • mikako horiuchi censoredcreampiesingle workFOCSabc mousou zokufocusFOCS-019FOCS019focs00019
    • 2021-09-18
    120 min

    [KSBJ-157]I Am Disciplined By My Two Stepsons. Mahiro Ichiki

  • mahiro ichiki censoredcreampiesquirtingKSBJksb kikaku emmanuellesakura ninKSBJ-157KSBJ157ksbj00157
    • 2021-09-19
    78 min

    526DHT-0106 Ramen Store Byte Taste Girl Aimi 20 Years Old

  • amateur censoredbig titsamateurdhtdht-0106dht0106526dht-0106
    • 2021-09-24
    63 min

    10musume 092421_01 AV Production Company Employee Is Punished For Skipping Work Without Permission Kyoko Suzuki

  • amateur uncensored10musume
    • 2021-09-25
    241 min

    [SGSR-286]Town Amateur College Girl Channel, Super Cute College Gal Looking For Work Yells "Don"t Look!" But Take Me To A Hotel! Being Real Is Important In Both Job Hunting And Fucking! 4 Hours 14 Women

  • censoredcreampieamateurSGSRbigmorkalshin sen kumiSGSR-286SGSR28657sgsr00286
    • 2021-09-29
    72 min

    FC2PPV 2262981 [Limited To 3 Days] * Immediate Dl Required Video * Gonzo Of The Gym Instructor Who Is About To Get Married Is Urgently Released. I Will Show You A Serious Wet Place Of Girls With Strong Sexual Desire In A Healthy Body. ≪No.97≫

  • amateur uncensoredfc2
    • 2021-10-24
    71 min

    200GANA-2585 Seriously Nampa, First Shot. Picking Up 1707 H-Cup Big Breast Nursery Teachers! Maybe It’s Because I’m Tipsy That I Don’t Get Angry Even If I Touch My Boobs, Or Maybe It’s Because Of My Sexual Desire … Sensitive

  • amateur censoredbig titssquirtingganagana-2585gana2585200gana-2585
    • 2021-10-28
    65 min

    OREX-321 Sarina-san 3 (Sarina Momonaga)

  • amateur censoredcreampiebig titsorexorex-321orex321orex-321
    • 2021-11-05
    119 min

    [DASD-934]Lubricated Slender Step-Sisters Rub Big Tits With Lotion Lovingly To Tempt Father-in-law Yu Shinoda Yuria Hakaze

  • shinoda yu yuria hafu censoredbig titsDASDdasmishima rokusaburoDASD-934DASD934dasd00934
    • 2021-11-13
    135 min

    [GVH-318]Double Big Tits Shame Hono Wakamiya Hazuki Wakamiya

  • honoka wakamiya wakamiya censoredbig titsGVHglory questusubashi suiGVH-318GVH318gvh00318
    • 2021-11-13
    136 min

    [GVH-317]Double Anal Bitches 9 June Lovejoy Ayaka Mochizuki

  • june lovejoy ayaka mochizuki censoredanalGVHglory questtorindoru tanakaGVH-317GVH317gvh00317
    • 2021-11-18
    44 min

    413INST-184 [Youth Orgy 2] ♂ ♀ 4 People Brain Iki With Continuous Vaginal Cum Shot In Adolescent Bunny! Completely Bitch Of Crazy Dick! A Cock Other Than My Boyfriend, Sticking Out My Tongue And Wanting A Belokis W (Aoi Rena Mai Yahiro)

  • amateur censoredcreampieschoolgirlinstinst-184inst184413inst-184
    • 2021-11-19
    81 min

    [FTHT-028][The Whiplashes of Love! Welts! Drooling, Teary Eyes, and Crying Tears of Joy during a Deep Throat! Ascension to Ecstasy!] A Local Idol from Hokkaido Leaps Ahead! Drastic Treatment where Her Ass is Whipped Until It Swells Up Bright Red! By

  • censoredcreampieFTHTfaleno tubedavielFTHT-028FTHT0281ftht00028
    • 2021-11-19
    141 min

    [DASD-938]Married Woman Cheating With A Black Guy - Secretary Gets Wet For Her Black Boss. Fucked Hard With His Huge Rod. Arisu Nanase

  • alice nanase censoredcreampiesingle workDASDdasmishima rokusaburoDASD-938DASD938dasd00938
    • 2021-11-25
    134 min

    [TOEN-056]Maho Ito - Amazing 44 Year Old. Soft Bodied Mature Woman. Doing Her AV Debut In Secret From Her Husband!

  • maho ito censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-056TOEN056h-086toen00056
    • 2021-11-25
    111 min

    [SPRD-1485]Forgive Me... I Want This Son-in-law"s C***d Mio Saionji.

  • mio saizonoji censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1485SPRD148518sprd01485
    • 2021-12-04
    174 min

    [SORA-348]Kind-Faced Girl"s Release Technique Is Magnificent. Neat and Clean Office Lady With Dick Addiction Will Suck Your Balls Dry Regardless Of Place. 10 Continuous Explosive Releases. Komari Ono.

  • komari ono censoredbig titsblowjobSORAyama to sorahimurokkuSORA-348SORA348sora00348
    • 2021-12-31
    178 min

    [MIFD-192]Amateur Who"s Popular With Y********ls Keeps Her Account Name Secret! Meet This Hot New Charismatic Influencer With 80,000 Followers! Porn Debut Of A Beautiful Young Influencer With A Beautiful Face, Hot, Slender Body, And Big Tits! Amu

  • amu kodama censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-192MIFD192mifd00192
    • 2022-01-09
    82 min

    383REIW-110 Yun A

  • amateur censoredcreampieamateurreiwreiw-110reiw110383reiw-110
    • 2022-01-29
    56 min

    [HEYZO-2708]Asaka Sera Deep Relationship With A Comforting Busty, Chickenhead Office Lady

  • asaka sera uncensoredcreampieblowjobheyzo



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored