housewife censored nampa jav high vision




FC2DASDATIDHDKAABWNNPJCJODVEMAHODVSHKDSQTEGVHFSDSSHNDDASDCHRVMILKSTARSRBDHUNTBAUKG

2020-10-23
20 min

[BTH-080]Double Kiss.

  • future sunohara yamamoto miwako censoredblowjoblingerieBTHchobitchchovicBTH-080BTH080h-1435bth00080
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-06
    190 min

    [HUNBL-019]My Little Stepsister Always Ignores Me But Keeps Up A Front With My Friends, So I Hit Her With Some Irrumatio And Fucked Both Her Holes, Top To Bottom, In A Threesome Creampie Fuck Fest

  • censoredcreampiesisterHUNBLhuntermasanorihhh groupHUNBL-019HUNBL019hunbl00019
    • 2020-11-07
    76 min

    H4610 ki201107 Gold Pack 20years old

  • amateur uncensoredh4610
    • 2020-11-17
    62 min

    SIRO-4324 [First shot] [Highest grade G milk] [Sexy husky voice] Big breasts x big butt OL. She shakes the powerful G milk that everyone longs for violently and keeps screaming pleasure with a blurred voice .. AV application on the net → AV experienc

  • amateur censoredbig titssquirtingsirosiro-4324siro4324siro-4324
    • 2020-11-19
    48 min

    285ENDX-315 Charismatic clerk of famous apparel who never releases Ji Po Squirting erotic female college student 2 consecutive villas Saddle cum shot

  • amateur censoredcreampieamateurendxendx-315endx315285endx-315
    • 2020-11-19
    120 min

    [TPPN-178]Drenched In Sweat! Cum! Pussy Juice! Moaning Sweetly Through Orgasmic Sex! Nana Maeno

  • nana maeno censoredsquirtingbeautiful girlTPPNteppanTPPN-178TPPN178tppn00178
    • 2020-11-20
    120 min

    [SPZ-1085]My MILF Caregiver Seduced On Camera

  • censoredamateurmature womanSPZstar paradisestar paradiesSPZ-1085SPZ1085h-254spz01085
    • 2020-12-09
    118 min

    [XVSR-570]While Husband Is Away On A Business Trip... Married Woman Cuckolded: Fucked For 26 Straight Hours By Perverted Custodian Yui Hatano

  • yui hatano censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-570XVSR570xvsr00570
    • 2020-12-10
    106 min

    485GCB-004 There is nuki, there is laughter, there is tears! Document AV monument, Bakusei! !! !! G cup big breasts beauty helps graduation from virginity ♪ Fair-skinned beauty with overwhelming beauty body boldly escorts! God open the heart of a vir

  • amateur censoredbig titsamateurgcbgcb-004gcb004485gcb-004
    • 2020-12-21
    240 min

    [GENM-068]Record Of A Second Year Of Growth - Eimi Fukada

  • emi fukada censoredslutGENMgenekigoldfish dGENM-068GENM068genm00068
    • 2020-12-23
    97 min

    [TG-083][Private Footage] Sex With A Slender Small-Titted Girl With Cute Rural Accent. Her First Time With A Huge Dick & D***king Cum [3 Cumshots]

  • censoreduniformTG1059 tokyoTG-083TG083h-1304tg00083
    • 2020-12-25
    78 min

    259LUXU-1359 Luxury TV 1344 A boxed girl who has been carefully raised by her parents makes an AV appearance! Ascend to outstanding foreplay while flushing her clear white skin and slender body! Taste the penis deliciously while wetting the secret pl

  • amateur censoredamateurluxuluxu-1359luxu1359259luxu-1359
    • 2021-01-01
    61 min

    Caribbeancom 010121-001 Caribbean Beauty Vol.32 Mai Amao

  • mai amao uncensoredanalcreampiecaribbeancom
    • 2021-01-18
    50 min

    IDJS-027 Mika

  • amateur censoredcreampiebig titsidjsidjs-027idjs027idjs-027
    • 2021-01-23
    212 min

    [DASD-803]Genuinely Addicted To Anal Fucking - Big Butthole Development SP

  • censoredanalDASDdaskogoro kindaichiDASD-803DASD803dasd00803
    • 2021-01-27
    119 min

    POW-037 Re Ze * mu ☆ Reverse Bunny

  • amateur censoredamateurcosplaypowpow-037pow037pow-037
    • 2021-02-04
    20 min

    FC2PPV 1672393 [Half price 500 yen] [Creampie for a married woman with a super-sensitive lorin body shape] “I am a bad married woman, but I like that myself” Dimension stop + anal licking + vaginal cum shot “From now on, I will do rout

  • amateur uncensoredfc2
    • 2021-02-05
    486 min

    [DCX-121]"I Can't Take Anymore..." But The Thrusts Don't Stop! Hot Big Booty Babes Pounded Doggie Style 40 Girls, 8 Hours BEST Collection

  • censoredcreampieDCXprestigedoc maxDCX-121DCX121118dcx00121
    • 2021-02-18
    56 min

    H0930 ki210218 Kanako Tomoi 43years old

  • amateur uncensoredh0930
    • 2021-02-25
    65 min

    FC2PPV 1701078 [Complete amateur 101] Azusa 19 years old, complete appearance, vaginal cum shot from the beginning! A masochistic G-cup girl.

  • amateur uncensoredfc2
    • 2021-02-28
    120 min

    [KSBJ-121]My Son's Wife Turned Out To Be A Slut Through And Through... Sumire Mizukawa

  • mizukawa violet censoredblowjobsingle workKSBJksb kikaku emmanuellebito sakuraKSBJ-121KSBJ121ksbj00121
    • 2021-03-01
    72 min

    FC2PPV 1706749 050 [Large amount of the juice busher] Erotic woman regardless of appearance ○ Student Yuuri’s impression is It feels better than my boyfriend 12 Doppyu is also good

  • amateur uncensoredfc2
    • 2021-03-16
    198 min

    [KIRE-029]A Real-Life Apparel Designer Who's Got "Wild Eros Company Style" And Will Step Out With Her Bra On Kozue Minami 26 Years Old Her Adult Video Debut

  • minami kozue censoredsingle workKIREsod createeasy matsumotobeauty kirei sodKIRE-029KIRE0291kire00029
    • 2021-03-30
    83 min

    279UTSU-503 Mirei & Ria

  • amateur censoredcreampiebig titsutsuutsu-503utsu503279utsu-503
    • 2021-04-01
    120 min

    [NACR-410]I Was Obsessed With The Breasts Of My Stepmom Miki Matsuzaka

  • miki matsuzaka censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-410NACR410h-237nacr00410
    • 2021-05-04
    61 min

    HEYZO 2515 A Horny Pussy New Employee Loves Queening With Smile – Asuka Uchiyama

  • asuka uchiyama uncensoredcreampiecumshotheyzo
    • 2021-05-05
    17 min

    FC2PPV 1803259 [Individual] A mother of two children who is exposed to outside passers-by, is tossed by another stick in the back of the vagina and drips sperm …

  • amateur uncensoredfc2
    • 2021-05-07
    42 min

    480FRIN-031 Daddy Live JD 19 Years Old [SEX Video Leaked] Raw Saddle Accepted On A Stealth Trip!

  • amateur censoredcreampieamateurfrinfrin-031frin031480frin-031
    • 2021-05-29
    150 min

    [LULU-073]Married Woman Realtor With A Perky Booty Can't Hide How Horny She Is For Her Hung Client During A Private Viewing. They Start With A Creampie Quickie And Keep Fucking Until She's Totally Satisfied. Ameri Hoshi

  • star ameri censoredcreampiesingle workLULUlunaticsluminaxLULU-073LULU073lulu00073
    • 2021-06-10
    161 min

    [DANDY-767]"If You Keep Touching Me There... I'm Going To Want To Fuck!" This Annoying Big Tits Lady Is Becoming A Member Of the M****ter Teachers By Pressing Her Big Titties Against This Naive And Innocent Young Boy vol. 2

  • censoredbig titsblowjobDANDYdandykikujiro otsuDANDY-767DANDY7671dandy00767
    • 2021-06-11
    119 min

    [MEYD-680]I Caught The Haughty Married Woman Next Door Working At A Brothel And Blackmailed Her Into Taking My Creampie! Now She's My Obedient Sex Pet Outside Of Work, Too Riona Hirose

  • rio hirose censoredcreampiesingle workMEYDtameike goroshiro shotenMEYD-680MEYD680meyd00680
    • 2021-07-03
    110 min

    [ANB-191]I'm Obsessed With My Beautiful And Erotic Step Aunt's Gorgeous Big Tits And Super Sexy Body Yuki Inaba

  • yuki inaba censoredsquirtingmature womanANBrubysusumu yanokuchinobleANB-191ANB191anb00191
    • 2021-07-03
    125 min

    [KTB-046]Office Girls Get Groped - Officer Workers Who Get Felt Up And Find Themselves Liking It Edition -

  • censoredbig titsbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-046KTB046ktb00046
    • 2021-07-31
    135 min

    [URKK-043]At Least 10 Times! The Big Titty Love Salon Where You Can Cum As Many Times As You Like On Bouncy Tits-Yuki Chitose

  • chitose in the evening censoredcreampiebig titsURKKunfinishedwild sevennyuukon no ichichichiURKK-043URKK043urkk00043
    • 2021-08-04
    60 min

    SIRO-4599 [First Shot] [Slut Service] [Indecent Ass Stakeout Piston] A Married Woman Wearing A Bewitching Atmosphere Appears With Her Husband’S Official Approval. A Beautiful Secretary Who Likes To Blame With A Switch On Soggy Caress Straddles A

  • amateur censoredmarried womanamateursirosiro-4599siro4599siro-4599
    • 2021-08-28
    240 min

    [BDSR-457]"Ah ... I"m ... Cumming ...!!" Women Who Can"t Keep Their Voices Down Unexpected Moans Of Pleasure 12 Ladies 4 Hours

  • southern eyebrow takarada monami censoreddramaBDSRbig mocaljiro kanekoBDSR-457BDSR45757bdsr00457
    • 2021-09-02
    82 min

    413INST-153 [Active Gravure] Leaked Gonzo ★ 10 Seconds Gravure Idol Private Reverse Bunny Cosplay Slut Taken At A Cosplay Photo Session

  • amateur censoredcreampiebig titsinstinst-153inst153413inst-153
    • 2021-09-04
    240 min

    [MMMB-056]Tight Leggings Hugging Her Ass And Pussy. Pimply Huge Ass And Legs Housewife 4 Hours

  • censoredbig titsMMMBmellow moonMMMB-056MMMB056mmmb00056
    • 2021-09-09
    84 min

    435MFC-140 [Quartet Of Beautiful Breasts, Nice Ass, Beautiful Legs, Beautiful Constriction] The Head Is Weak, But Sex Is Good! The Number One Gal Who Wants To Be A Saffle Is Here! It’S Fun Just To Be Together! Nori Is Good! Good Body! Miku-Chan&

  • amateur censoredcreampiebig titsmfcmfc-140mfc140435mfc-140
    • 2021-09-11
    126 min

    [CEMD-056]Non-Stop Mature Woman Lesbian Series! Saya Minami Miho Tomii Honami Akagi Airi Takasaka These 4 Horny Mature Woman Babes Are Cumming Non-Stop!

  • minami saya miho tomii censoredlesbianmature womanCEMDserebu no tomoCEMD-056CEMD056cemd00056
    • 2021-09-18
    115 min

    [BIJN-207]The Document. Instinct To Show Off Fully For Climaxing Sex. Pleasure Seeking Married Woman Breaks Boundaries For Quick Pounding Creampie Orgy. Yuri Sasahara

  • yuri sasahara censoredcreampiesingle workBIJNbijin majoBIJN-207BIJN207bijn00207
    • 2021-10-01
    99 min

    [ADN-346]Dear, Please Forgive Me... A Second Wife"s Conflict - Minami Shiratori

  • minami shiratori censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-346ADN346adn00346
    • 2021-10-01
    124 min

    [MIDE-978]Nonstop Pleasure, Grinding Sex, And Endless Squirting Orgasms Starring Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsMIDEmoodyzdoragon nishikawamoodyz divaMIDE-978MIDE978mide00978
    • 2021-10-08
    154 min

    [IPX-747]Coercion From An Intense Older Guy That Makes Me Take His Dirty Dick Every Single Day. Late-night Nurse Call That Signals To A Sexual Service. Nanami Misaki

  • nanami misaki censoredcreampieblowjobIPXidea pocketmaeda bungoutissueIPX-747IPX747ipx00747
    • 2021-10-15
    121 min

    [FOCS-026]The Discovery Of A Genius!？ She"s Living Life And Enjoying Every Second LOL Even A Delayed Ejaculator Will Immediately Cum When She Whips Out Her Tongue Techniques And Get You Sensitized To The Max With A Perfect And Explosively Fast Co

  • miku kurusu censoredbig titsblowjobFOCSabc mousou zokufocusFOCS-026FOCS026focs00026
    • 2021-10-29
    154 min

    [CAWD-305]Enjoy Flesh Fantasy Angles While Viewing Coquettish Babes In Super Up Close Shots And Lavish Over Their Fabulous Bodies Nozomi Arimura

  • arimura nozomi censoredbig titssingle workCAWDkawaiitake dCAWD-305CAWD305cawd00305
    • 2021-11-19
    240 min

    [REXD-386]A Sought-After Fresh Face Nun! The Perverted Chief Priest"s Eccentricity: "Wet Your Crack so that it is Soaking Wet Like This..."

  • censoredcreampieREXDredmanji groupREXD-386REXD386rexd00386
    • 2021-12-10
    69 min

    FC2PPV 2504509 * Loli Big Breasts Revolution 2nd [National Treasure G Cup] Brush wholesale, fucking, middle 〇. I attacked the sneak peek and tried to squeeze the seeds

  • amateur uncensoredfc2
    • 2021-12-10
    60 min

    SIRO-4729 [First Shot] [Frustrated Married Woman] [Super Sensitive Beauty Body] She Is Sexless With Her Husband And Decides To Appear Because She Can Not Suppress Her Strong Sexual Desire. Transformed Into A Female Face, The Hot Flashed Body Culminat

  • amateur censoredmarried womanamateursirosiro-4729siro4729siro-4729
    • 2021-12-25
    151 min

    [GNAX-062]A Married Woman Screaming In Broad Daylight Who Can Never Show Her Husband First Time Filming Document Version Sayuri Akiyoshi 36 Years Old

  • akiyoshi sayuri censoredcreampiesingle workGNAXnagiranagira kenzonagira nagiraGNAX-062GNAX062gnax00062
    • 2022-01-07
    128 min

    [VEC-512]Abduction NTR - My Beloved Wife Was Fucked By A Criminal Yuko Shiraki

  • shiraki yuko censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-512VEC512vec00512
    • 2022-01-14
    119 min

    [EBOD-887]Reverse NTR! Reverse Fuck! Big Tits Gal Sister ERINA Fucks New Worker"s Nipple, Anal And Glans With 3 Point Fuck

  • erina censoredcreampiebig titsEBODe bodylamb chopEBOD-887EBOD887ebod00887
    • 2022-01-20
    51 min

    C0930 ki220120 Yui Mizuguchi 22years old

  • amateur uncensoredc0930
    • 2022-01-27
    36 min

    FC2PPV 2628137 Encourage A Young Wife Who Dislikes It Because Of Her Hardship To Lend And Commit It As Collateral. [No Line Of Sight Due To Emergency]

  • amateur uncensoredfc2
    • 2022-01-28
    162 min

    [WAAA-140]Erotic Tongue Trance! Helpless Men Are Left In A Daze From Cumming! Starring Riho Fujimori

  • riho fujimori censoredcreampieslutWAAAwanz factorywanzWAAA-140WAAA140waaa00140



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored