housewife high vision creampie hours more censored




FC2HODVMIDVMEYDDASDWAAANATRSSNISPRDHNDLULUVENXVENUAMBIMILKONEZAUKGBLKKSBJGMEMHDKA

2020-09-05
46 min

FC2PPV 1491817 No.23 20 years old I took a gonzo privately with the popular No. 1 men’s beauty salon.

  • amateur uncensoredfc2
    • 2020-09-17
    119 min

    [SSNI-873]The Night Of A Business Trip In Which A Beautiful Office Lady Had Her Vagina Pounded All Night By Her Superior, Having Adulterous Sex In A Shared Room NTR - Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingbeautiful girlSSNIs1 no 1 stylebungo maedaSSNI-873SSNI873ssni00873
    • 2020-10-01
    55 min

    FC2PPV 1520116 [Personal shooting / set sale] Married woman who continuously shoots stick semen in the mouth full version

  • amateur uncensoredfc2
    • 2020-10-07
    76 min

    432YKMC-035 Mai

  • amateur censoredmarried womanamateurykmcykmc-035ykmc035432ykmc-035
    • 2020-11-25
    240 min

    [ZOOO-013]Seducing A Working Married Woman / Mature Woman! A Sexy And Beautiful Mature Woman Is Getting Excited During Infidelity Sex And Rampaging Out Of Control! 4 Hours 10 Ladies

  • censoredcreampiemarried womanZOOOzoooZOOO-013ZOOO013h-1515zooo00013
    • 2020-12-02
    72 min

    FC2PPV 1592116 [Personal shooting / set sale] Wife who entrusts her child and eats another stick for her desires 1st & 2nd

  • amateur uncensoredfc2
    • 2020-12-05
    119 min

    [ATID-445]If You Can Help Me I'll Give You My Anal Hole, Teacher... Riho Yuki

  • riho yuki censoredanalsingle workATIDattackerseitaro hagaein madATID-445ATID445atid00445
    • 2020-12-06
    94 min

    [VENU-982]"They Barely Fit In Here" Sex In The Bath With My Busty Mother-In-Law Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsVENUvenussarufakecest winntersVENU-982VENU982venu00982
    • 2020-12-10
    86 min

    [ant-010]あいちゃん 2(22)

  • amateur censoredamateurblowjobantant-010ant010ant-010
    • 2020-12-11
    78 min

    300MAAN-608 [Advent to drink a beautiful breast beauty gala with 100 transparency] Outstanding proportions on the baby face! A date to enjoy Yokohama with a cute and graceful beauty with a smile → Gala drinking 3P sex night ♪ The true identity of a c

  • amateur censoredcreampieamateurmaanmaan-608maan608300maan-608
    • 2020-12-13
    106 min

    390JNT-012 [Seriously juice-covered SP] SNS picking up a metamorphosis nurse of a body fluid enthusiast who puts an erotic selfie on Lee ● Star! !! A transcendental metamorphosis nurse who plays pee in private! Beautiful big tits & Momojiri are c

  • amateur censoredcreampiesquirtingjntjnt-012jnt012390jnt-012
    • 2020-12-31
    102 min

    [ADN-285]Dual Cheating In A Shared Room - Nailed By The Boss I Trusted Hikari Kisaki

  • hikari hime censoredbig titssingle workADNattackerskinotona no dramaADN-285ADN285adn00285
    • 2021-01-22
    79 min

    [DHT-231]Picking Up First-Rate MILFs - Beautiful Mature Creampie Sex JAPAN - Ms Minami, Age 40

  • censoredbig titsmarried womanDHThot entertainmentstudio zeroDHT-231DHT23159dht00231
    • 2021-01-22
    66 min

    [orex-195]えりな 2

  • amateur censoredcreampieamateurorexorex-195orex195orex-195
    • 2021-01-29
    243 min

    [NANX-218]A Pretty & Horny Woman Picks Up Innocent-Looking Amateur Girl On The Street For Some Lesbian Action 2

  • censoredlesbianmature womanNANXnanpa heavenjun nagasawaNANX-218NANX218h-891nanx00218
    • 2021-01-29
    109 min

    FC2PPV 1664477 3Q Legend ♥ ️ Urgent Limited Release ♥ ️ Tsundere Beauty Receptionist With Beautiful Breasts, Nice Bottoms, Beautiful Legs Revives A Miracle ♥ ️ First Experience SM Insistence ○ Losing Pride And Shame In Play Incontinence Acme & Va

  • amateur uncensoredfc2
    • 2021-02-01
    62 min

    Pacopacomama 020121_429 Rental wife who does perfect sexual job Aina Kitahara

  • amateur uncensoredpacopacomama
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-22
    111 min

    [AVSA-158]美少女串刺し輪● 憧れのあの娘が汁まみれで犯●れ続けた。初恋の相手・いちかが輩にオモチャにされるのを覗いて鬱勃起 松本いちか

  • ichika matsumoto censoredsingle workAVSAavshiroyuki kimuraavscollectorAVSA-158AVSA158avsa00158
    • 2021-03-24
    82 min

    FC2PPV 1739436 980 yen! Big breasts J cup ♪ First shot suddenly vaginal cum shot! The tight boobs are sloppy ♪ Although I am puzzled by the body that is too sensitive, I forget to shoot and drown in pleasure and die! 21-year-old JD3 May-chan Chapter

  • amateur uncensoredfc2
    • 2021-04-03
    59 min

    HEYZO 2493 That Whispered Married Busty Woman Is Cum Swallow Lover!？ – Rino Sakuragi

  • rino sakuragi uncensoredcreampieblowjobheyzo
    • 2021-04-09
    104 min

    FC2PPV 1761438 "Most of the time! Ku □ E-kun!" Beautiful legs-san de Pikone Naka ○ Shibe Ku □ Echiechi edition [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-15
    134 min

    [CMV-153]Priestess With Big Tits Falls Into Rope Bondage Hell Living Sacrifice Wooden Horse Play Ai Shinkawa 7

  • aishin shinkawa censoredcosplaysingle workCMVcinemagicmarukatsuvixenCMV-153CMV153cmv00153
    • 2021-05-15
    54 min

    10musume 051521_01 7 month Naughty Prego Wife Wants to Get Fucked by Another Man Hiroko Ookubo

  • amateur uncensored10musume
    • 2021-05-15
    251 min

    [SORA-313]Slutty S********l Exposes Herself I Was Appointed To Be The Record-Keeper Rion Izumi

  • rion izumi censoredslutsingle workSORAyama to soratelephone poleSORA-313SORA313sora00313
    • 2021-05-20
    88 min

    [YOZ-386]Gorgeous Call Girl Delivered To Your Door 2

  • censoredbig titslingerieYOZstar paradiseyaozokuYOZ-386YOZ386h-254yoz00386
    • 2021-06-02
    61 min

    422ION-0069 A Yariman Woman Awakens To A Big Cock And Is Promoted To A Cock Saffle

  • amateur censoredcreampiebig titsionion-0069ion0069422ion-0069
    • 2021-06-11
    124 min

    [DASD-875]Thanks For The Stepmom/Stepdaughter. I Knocked The Stepmom Up Decades Ago, Now It's The Stepdaughter's Turn. Michiru Kujo Kotone Toa

  • kujo michiru toua kotone censoredmature womanbeautiful girlDASDdaschinpo dazaiDASD-875DASD875dasd00875
    • 2021-06-11
    60 min

    383REIW-072 Sumire

  • amateur censoredamateurslutreiwreiw-072reiw072383reiw-072
    • 2021-06-17
    150 min

    [CMV-155]Ballerina Tied Up Tight With Rope Pretty Girl Has Her Pussy Relentlessly Played With Riri Momoka

  • peach scent censoredcosplaybdsmCMVcinemagicmarukatsuvixenCMV-155CMV155cmv00155
    • 2021-06-26
    47 min

    C0930 ki210627 Kayoko Yuge 31years old

  • amateur uncensoredc0930
    • 2021-07-02
    61 min

    230OREC-811 Ran

  • amateur censoredcreampieamateurorecorec-811orec811230orec-811
    • 2021-07-08
    64 min

    SIRO-4570 [First shot] [Sweaty sexual intercourse] [Neat wife of obscene BODY] The neat wife who has been absent from her husband is on the verge of exploding her inner sexual desire. She turned on her and licked a man’s nipple while feeling des

  • amateur censoredmarried womanamateursirosiro-4570siro4570siro-4570
    • 2021-07-14
    70 min

    428SUKE-079 [F Cup + Shaved Beauty And Creampie Trip] Borrow A Mobile Battery And Pacopaco Sp With Students Just Before Summer Vacation! !! It’s Amazing When You Take It Off! ？？ F Cup Boobs Explode! Watching Av Makes You Horny → Eliminates Libid

  • amateur censoredcreampiebig titssukesuke-079suke079428suke-079
    • 2021-07-15
    120 min

    [AQSH-073]Naughty Bride Teases Her Father-In-Law With Nipple And Cock Teasing To Drain His Balls Dry Nono Yuki

  • yuki s censoredmature womansingle workAQSHaquamall heroaquamallAQSH-073AQSH073aqsh00073
    • 2021-07-23
    57 min

    383REIW-084 Seria

  • amateur censoredcreampiebig titsreiwreiw-084reiw084383reiw-084
    • 2021-08-01
    123 min

    [NACR-442]The Case Of My Father"s Young, Beautiful Second Wife Being A Horny Slut. Sumire Kurokawa

  • sumire kurokawa censoredcreampiemature womanNACRplanet plusdirector oshichi ku ryuuNACR-442NACR442h-237nacr00442
    • 2021-08-11
    69 min

    016DHT-0283 Polite Adultery Between Seniors Naomi-San 48 Years Old

  • amateur censoredmarried womanmilfdhtdht-0283dht0283016dht-0283
    • 2021-08-27
    102 min

    [YST-254]Decency Or Vulgarity Doesn"t Really Matter But I Want To Play With Shiomi Like Crazy. Aya Shiomi

  • aya shiomi censoredcreampiedeepthroatYSTkoyachoYST-254YST254540yst00254
    • 2021-09-17
    189 min

    [MIAA-499]She Gave Me A Massage, And When I Got An Erection, She Rubbed Her Pussy Against My Tip And Now My Cock Was Digging 2cm Into Her Panties, And Now I Was Absolutely Certain That This Massage Parlor Therapist Was Luring Me To Temptation PART 2

  • censoredcreampieslutMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-499MIAA499miaa00499
    • 2021-09-18
    45 min

    276KITAIKE-495 Mizuki-San

  • amateur censoredcreampieamateurkitaikekitaike-495kitaike495276kitaike-495
    • 2021-09-18
    142 min

    [KAGN-006][Self Shots] Blowjobs Anywhere4: 11 People

  • censoredamateurblowjobKAGNkaguya hime pt mousozokuikeda fukuroukaguya hime ptKAGN-006KAGN006kagn00006
    • 2021-09-24
    119 min

    [HMN-048]THE FIRST TAKE I Want To Become A Sexy Voice Actress! She Took On This Babymaking, Erotic And Grotesque Script And Redubbed All The Dialogue In One Continuous Take, Filled With Raw Cocks And Creampie Sex Aoi Amano

  • ao amano censoredcreampiebig titsHMNhonnakataiga kosakaiHMN-048HMN048hmn00048
    • 2021-10-01
    150 min

    [NNPJ-475]Men"s Spa Girl Works Hard To Get A Dick Up Voyeur Style (College Girl, 20). This Teasing Temptress Works A Dick Right Up To The Edge With Teasing Before Ending With A Raw Creampie. Mao (Alias).

  • censoredcreampiebeautiful girlNNPJnampa japanNNPJ-475NNPJ475nnpj00475
    • 2021-10-01
    86 min

    300MAAN-702 [Legendary! Loli Face X Big Breasts X Beautiful Girl] Rabbit Girls In The Perennial Estrus Period Who Yearn For Carnivorous Are Super Naive, But Their Sexual Desire Is More Than Anyone! "Because It’s M, I Want You To Blame Me A L

  • amateur censoredcreampiebig titsmaanmaan-702maan702300maan-702
    • 2021-10-15
    122 min

    [FOCS-027](Full POV) Amazing Cosplay For A Hot And Flirty Experience! Super Cute Girl Gives Dirty Talk And Lewd Lip Sounds While Giving A Blowjob For Irresistible Loving Sex. Mio Mashiro

  • mio mashiro censoredcosplaysingle workFOCSabc mousou zokufocusFOCS-027FOCS027focs00027
    • 2021-10-30
    130 min

    [PKPL-011]1K Room Swallow Document - I Tried Fucking Beautiful Tits Pink Nipple Goddess Maina Yuri In Her Room for 1 Day

  • yuuri censoredcreampiebig titsPKPLpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPL-011PKPL011pkpl00011
    • 2021-11-06
    154 min

    [MDBK-207]Explosive Nookie Ejaculation Skills, Used To Toy With Men While They"re Tied Up Welcome To The Titty Fuck Club, A Brick And Mortar Palace Of Pleasure Where You"ll Be Subjected To Slick And Slippery Titties To Get You Hot And Excited

  • tsujii honoka inaba censoredbig titsslutMDBKk m producebazookaMDBK-207MDBK207mdbk00207
    • 2021-11-06
    71 min

    422ION-109 Iori (Momoka Kato)

  • amateur censoredamateurblowjobionion-109ion109ion-109
    • 2021-11-08
    33 min

    FC2PPV 2412767 Limited Number! [Uncensored] Innocent School Ponytail Black-Haired Female College Student! Pretty Looks But Tight Bristles … I Can’t Help But Feel Embarrassed And Cum Inside "Part 2"! !! (Blow Scene Appearance)

  • amateur uncensoredfc2
    • 2021-11-08
    81 min

    [SDFK-059]Friends" First Time Taking The Two-Way Mirror Train To Go To The Beach! Playing Tw*ster In Their Shameless Swimsuits And Rubbing Their Nether Regions Together, Will They Get All The Way To "Summer Memory SEX"!？ Rumi-chan (Colleg

  • censoredbig titsSDFKsod createchain sectmagic mirrorSDFK-059SDFK0591sdfk00059
    • 2021-12-01
    126 min

    [NACR-489]Wife Of Boss Tempts Me By Showing Boobs With V-Neck Sweater. Ayaka Makimura

  • ayaka makimura censoredcreampiebig titsNACRplanet plushimu locknanakuruNACR-489NACR489h-237nacr00489
    • 2021-12-03
    116 min

    [NNPJ-482]Married Woman Using Social Media - Picking Up Girls Techniques. Ordinary Married Woman That Lives In An Apartment And Just Wears 980 Yen Hoodies Puts On A Kimono And Goes Out On A Special Date, Leading To A Simple Affair With Fucking. Mako

  • censoredcreampieNNPJnampa japanNNPJ-482NNPJ482nnpj00482
    • 2021-12-10
    191 min

    [NKKD-237]Dramatic NTR22: The In-car Camera Saw The Whole Thing.

  • censoredmature womanNKKDjet eizomanji groupNKKD-237NKKD237nkkd00237
    • 2021-12-16
    82 min

    [GIHHD-085]Girigura! Treasure House!! Asuka Hinata

  • asuka hinata censoredsingle workGIHHDbaguschikara sawamuraGIHHD-085GIHHD085h-305gihhd00085
    • 2021-12-18
    126 min

    [GVH-333]Big Titted Bride Receives Anal Training From Father-In-Law All Over The House Mako Oda

  • oda mako censoredanalsingle workGVHglory questtorindoru tanakaGVH-333GVH333gvh00333



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored