housewife young wife javcensored creampie jav




FC2MIDVSPRDMIAAFSDSSWAAAVEMAGVHMEYDCAWDAUKGVENUONEZPREDPPPDVENXJULMARAAVSACESDADN

2020-09-18
117 min

[DOCP-246]32 Years Old A Horny Wife... Her Second Virginity Was Deflowered In A Five-Way Creampie Fuck Fest Echika Akai

  • akai echika censoredcreampiesingle workDOCPprestigedoc premiumDOCP-246DOCP246118docp00246
    • 2020-09-20
    150 min

    [DASD-731]Extreme Cowgirl Temptation - Secretary Who's Got Her Own Cock. Sara Aizawa

  • aizawa sara censoredsingle workDASDdasnao masakiDASD-731DASD731dasd00731
    • 2020-09-24
    94 min

    [IENF-103]Big Tits Girl's Clit Up Close! Uncensored Back to Back Orgasm Masturbation In Panties 2

  • nakagusuku kamisaki mai censoredbig titsIENFienergyienfIENF-103IENF1031ienf00103
    • 2020-10-11
    55 min

    FC2PPV 1530799 Idol ♀ J②] partⅡ 〇Twin angels who picked up in a bag are brought into the spear room and Gonzo seeding [Super beautiful woman with a slope face x 2]

  • amateur uncensoredfc2
    • 2020-10-15
    58 min

    [orec-618]すず

  • amateur censoredcreampiebig titsorecorec-618orec618orec-618
    • 2020-10-16
    132 min

    [MBDD-2046]Rika Omi / Pretty!

  • rumi tadami censoredbeautiful girlsingle workMBDDmedia brandhideo shimomuraprettyMBDD-2046MBDD2046301mbdd02046
    • 2020-10-20
    240 min

    [TKBN-019]Hidden Camera! Usually I'm A Very Serious Housewife, But... I Show A Young Man My Nasty Talents That Even I Didn't Know I Had! 240 Mins

  • censoredTKBNstar paradisetreasure shipTKBN-019TKBN019h-254tkbn00019
    • 2020-11-06
    59 min

    FC2PPV 1560667 First shot ❤️ Fair-skinned F cup JD ❤️ When you see an overwhelming beauty in front of you, sperm is infinite! 【selfie】

  • amateur uncensoredfc2
    • 2020-11-13
    58 min

    328HMDN-311 [Demon cock x married woman] The secret of a mom who never wants to be seen by her 3-year-old son Gonzo personal shooting [Amateur personal shooting] who wants to insert himself with a raw cock

  • amateur censoredcreampiemarried womanhmdnhmdn-311hmdn311328hmdn-311
    • 2020-11-20
    44 min

    [SHYN-132]SOD Female Employees - Strip Rock-Paper-Scissors - Girl Sent To Help On-Location Filming Rises To The Challenge! Editing Department Yoko Sakuraba

  • yoko sakuraba censoredbeautiful girlSHYNsod createy 10432sod female employeeSHYN-132SHYN1321shyn00132
    • 2020-12-01
    130 min

    [SDDE-637]The Inner Sanctum Room - Welcome To My Very Own Horny Married Woman Apartment House, Yay! -

  • ayano kato yano tsubasa censoredcreampieslutSDDEsod createryo inugamisenzSDDE-637SDDE6371sdde00637
    • 2020-12-01
    89 min

    261ARA-467 [Too beautiful married woman] 27 years old [Slender big tits] Mami-san is here! The reason for her application to steal her husband’s eyes and repeat cheating is “I have a desire to see sex … ♪” The opposite of cleanlin

  • amateur censoredsquirtingamateuraraara-467ara467261ara-467
    • 2020-12-10
    92 min

    [OKZ-014]Mature Goddess - Sex-Starved 40-Year-Old Woman Ryo Gets A Sexy Secret Part-Time Job Without Telling Her Family - Last Time She Had Sex Was Several Years Ago. Mature Married Woman On The Verge Of Exploding Due To Unfulfilled Desires Has A Sup

  • ryo fukutomi censoredcreampiemature womanOKZdaddy s private photosgodly mature womanOKZ-014OKZ0141okz00014
    • 2020-12-20
    152 min

    [HND-923]A Tanned And Healthy College Girl Gets Her First Raw Creampie Fuck Toa Nanashima

  • toai nanami censoredcreampiebeautiful girlHNDhon nakausa pyonHND-923HND923hnd00923
    • 2020-12-24
    75 min

    326EVA-150 Saffle is growing due to devilish desire ww In the past, 3P experience ants in Carsek & mountains during BBQ! !! Duero GAL who picked up the sea and [mouth x 1] [creampie x 3] [sperm 4 barrage] fierce pacoli! !! Rough big butt trained

  • amateur censoredcreampieamateurevaeva-150eva150326eva-150
    • 2021-01-22
    107 min

    [DKD-003]You Said You'll Become A Dad Tomorrow, Are You Sure You Should Be Doing This？ Mizuki Yayoi

  • mizuki yayoi censoreduniformslutDKDdream ticketnishiki sasaDKD-003DKD00324dkd00003
    • 2021-01-22
    240 min

    [ZOOO-019]Performances You Can Only Get Here! All Real Seductions! Sexy Tanned Thai Babes With Dazzling Smiles. 10 Girls, 4 Hours

  • censoredamateurZOOOzoooZOOO-019ZOOO019h-1515zooo00019
    • 2021-01-24
    63 min

    299EWDX-345 The F cup 145cm mini loose fluffy wife was a carnivorous wife who pleaded for a kiss from herself!

  • amateur censoredmarried womansquirtingewdxewdx-345ewdx345299ewdx-345
    • 2021-01-25
    71 min

    [GREDB-1021]Love Scandal / Yuki Shiraishi

  • censoredbig titsbeautiful girlGREDBintec incGREDB-1021GREDB1021h-706gredb01021
    • 2021-01-28
    82 min

    [opsen-016]カミ

  • amateur censoredbig titsuniformopsenopsen-016opsen016opsen-016
    • 2021-02-06
    151 min

    [SHKD-929]Art Department Teacher Made Into An Artist's Model Minori Hatsune

  • hatsune minori censoredsingle workSHKDattackersbungo maedasharkSHKD-929SHKD929shkd00929
    • 2021-02-17
    59 min

    SIRO-4428 [First shot] [Cool girlfriend ..] [Smeared in cloudiness] A serious girl with a cool reaction actually made a big stain on her underwear. Honest body seeks pleasure .. AV application on the net → AV experience shooting 1466

  • amateur censoredamateursirosiro-4428siro4428siro-4428
    • 2021-02-19

    FC2PPV 1692697 [Uncensored / Individual shooting] The second installment of Yua-chan, an active model of F-cup beautiful breasts! Erotic diagnosis by a female doctor. [* Immediate deletion of body baldness]

  • amateur uncensoredfc2
    • 2021-03-04
    488 min

    [AKDL-092]We Found 4 Pretty Working Girls In Town With Sensitive Bodies Who Just Happen To Be Subs! Risa, Age 26, Works In Publishing/Kanon, Age 24, Works For An Office Supplies Distributor/Kana, Age 25, Construction Company Clerk/Yukina, Age 24, Rec

  • rio okita nakajo cano censoredsquirtingAKDLaquinoriaquinoriaknrAKDL-092AKDL0921akdl00092
    • 2021-03-17
    37 min

    492MERC-274 Knowledge of H is almost zero

  • amateur censoredcreampieschoolgirlmercmerc-274merc274492merc-274
    • 2021-03-18
    87 min

    435MFC-089 Gonzo welcome model-class beauty body Yoka JD and raw SEX [Shiroto Gonzo ＃ Mone ＃ 20 years old ＃ E cup (female college student)]

  • amateur censoredcreampiebig titsmfcmfc-089mfc089435mfc-089
    • 2021-03-25
    120 min

    [013ONEZ-280]【完全主観】あざと可愛いお下品変態メイドさんはお好きですか？成田つむぎ

  • amateur censoredcreampieamateuronezonez-280onez280013onez-280
    • 2021-04-02
    58 min

    FC2PPV 1743341 [Personal shooting] Kanade 32 years old Massive launch to a sweat duck beautiful wife with outstanding style F cup beauty big tits

  • amateur uncensoredfc2
    • 2021-04-03
    152 min

    [BOKD-215]Porn Debut I Look Like A Girl But I Actually Have A Penis Fuyuka Natsu

  • censoredanalcreampieBOKDwe re she malesdorikawaBOKD-215BOKD215bokd00215
    • 2021-04-10
    61 min

    383REIW-055 Waka

  • amateur censoredbig titsamateurreiwreiw-055reiw055383reiw-055
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-30
    235 min

    [FAVKH-003]The Ultimate Beautiful Married Woman Babes Are Secretly Making Their Adult Video Debuts Behind Their Husbands' Backs Nene-san Is A Super-Class Beautiful Wife With A Super Sensual, Perverted Body And She's Giving All Of Her Saliva,

  • jinguji temple nao yuka aoba censoredcreampiebig titsFAVKHarisebride in love dx ariseFAVKH-003FAVKH003h-1577favkh00003
    • 2021-05-08
    124 min

    [MDTM-725]My Favorite Lady Boss Was Sexy And Cute, And Now She Was All Mine. After Missing The Last Train Home, We Spent The Night At A Love Hotel ... And Then We Kept On French Kissing And Having Deep And Rich Sex Until The Break Of Dawn. Natsu Tojo

  • natsu tojo censoredcreampieuniformMDTMuchu kikakutodoMDTM-725MDTM725mdtm00725
    • 2021-05-28
    121 min

    [MIAA-444]Teaching A Super Impertinent Brat A Lesson By Grabbing Her And Fucking Her Hard Ichika Matsumoto

  • ichika matsumoto censoredcreampiedeepthroatMIAAmoodyzsuisei akaieveryone s porn starMIAA-444MIAA444miaa00444
    • 2021-06-01
    140 min

    [TWT-037]She's Pissing In Her Bloomers!! Girls With Sensitive Pussies Who Piss Themselves With Orgasmic Pleasure Through The Big Vibrator Blame Game

  • censoredamateurTWTsarutoru video publishertwin tailsTWT-037TWT037h-897twt00037
    • 2021-06-16
    195 min

    [DVDMS-677]A Cheerful College Girl With A Great Smile, And Dazzlingly Wonderful Short Hair 18 Years Old A Fresh Face Kiu Aihara An Adult Video Debut We Couldn't Seduce Her On the Magic Mirror Number Bus, But ... "The Truth Is, I Really Want T

  • aihara tsukiha censoredbeautiful girlsingle workDVDMSdeep sfunky hasegawaDVDMS-677DVDMS677dvdms00677
    • 2021-06-16
    120 min

    [GVH-250]Beautiful Teacher Stuck In Delinquent S*****t's Web - Rin Kira

  • kira rin censoredsingle workGVHglory questkimura hajimeGVH-250GVH25013gvh00250
    • 2021-06-17
    118 min

    [DDOB-094]Tongue-Twisting Shame Witness The Scream Of The Deep Throat Anaconda Yumi Saeki

  • yuka saeki censoredcreampiemature womanDDOBdogmatenunmy auntDDOB-094DDOB094ddob00094
    • 2021-06-19
    40 min

    519MAZOF-003 [Excitement] WEB media management site President ♀ 38 years old An estrus female who panting on a man’s penis at night, even though he is a man with a mission of "women’s success". I’m pleased to be hit in the ass

  • amateur censoredcreampieamateurmazofmazof-003mazof003519mazof-003
    • 2021-06-22
    51 min

    FC2PPV 1882302 Active JD who aspires to be a professional pianist and attends music college with a scholarship accepts rimming and vaginal cum shot on the forward lip for life * Super valuable * [Restore] Deleted account video File.0021

  • amateur uncensoredfc2
    • 2021-07-14
    61 min

    494SIKA-096 3P Sex With A Beautiful Girl With No Makeup

  • amateur censoredcreampieschoolgirlsikasika-096sika096494sika-096
    • 2021-07-14
    217 min

    [DVDMS-692]Neighborhood MILFs With Big, Perky Asses Given A Quickie! 5 - Hot Married Woman Seduced By Stud Into Taking Hard Cock, She Forgets It All For Incredible Orgasms! "You're Still Cumming, Aren't You...？" Her Big Fleshy Asses B

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-692DVDMS692dvdms00692
    • 2021-07-17
    238 min

    [NPJB-061]17 Amateur Girls' Embarrassing Anal Picture Book Full View Anal SEX

  • censoredanalcreampieNPJBnanpa japanNPJB-061NPJB061npjb00061
    • 2021-07-23
    121 min

    [XVSR-607]The Married Woman Makes A Cuckold Of Her Husband While He Is On A Business Trip - Going At It Non-Stop For 26 Hours With Her Neighbor - Hibiki Otsuki

  • otsuki sound censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-607XVSR607xvsr00607
    • 2021-08-11
    80 min

    259LUXU-1455 Luxury TV 1442 A Cosmetologist With A Model-Like Style Is Here! A Cute Smile Like A Girl And A Manly Act. When It Becomes Sex And The Switch Is Turned On, It Transforms Into An Unpleasant Adult Woman! A Beautiful Style That Is Wet With O

  • amateur censoredamateurluxuluxu-1455luxu1455259luxu-1455
    • 2021-08-16
    71 min

    [MISG-003]Creampie Sex With A Girl Who Is Annoyed For Some Reason And Treats Me Coldly Yu Shinoda

  • shinoda yu censoredcreampiebig titsMISGstimulation strongjohnny shibuyaMISG-003MISG003misg00003
    • 2021-09-17
    170 min

    [MVSD-481]Mazakon (Oedipus Complex). I Remember Getting My Nipples Played With And Fondled By An Older Guy For Days On End. Mai Kagari

  • flower hunting censoredcreampieschoolgirlMVSDm s video groupms video groupMVSD-481MVSD481mvsd00481
    • 2021-09-23
    63 min

    Caribbeancom 092321-001 Loving Slow Sex With Plenty Of French Kiss Rena

  • rena uncensoredcreampiecaribbeancom
    • 2021-10-29
    39 min

    FC2PPV 2384788 [Mama Barre] [During The Appearance] A Niece Who Can Switch On The Vibrator In The Vagina While Calling Her. This May Be The Last Because She Has Been Suspected

  • amateur uncensoredfc2
    • 2021-11-11
    107 min

    [SPRD-1481]Fucking Daughter"s Mate Chisato Shoda

  • shota chisato censoredsingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1481SPRD148118sprd01481
    • 2021-11-12
    74 min

    529STCV-032 [Sperm Sommelier] Slender Beautiful Girl J System And Kneading! Rich Sex With "A" Who Is A Metamorphosis Who Is Particular About The Taste Of Sperm! I Research Ochin ● Every Day In Search Of Delicious Sperm. Today’s Sperm Was

  • amateur censoreduniformschoolgirlstcvstcv-032stcv032529stcv-032
    • 2021-11-19
    120 min

    [SSIS-246]The Nurse Call Button With A Titty Fuck Option - Cumshots Available Anytime! J-Cup Nurse Will Service You Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-246SSIS246ssis00246
    • 2021-11-19
    141 min

    [JUL-779]"Hey, Are You Really a Cherry Boy？" - The Fake Cherry Boy Makes the Married Woman Come Like Crazy - Kanae

  • ai kano censoredbig titsmature womanJULmadonnatomitake taroJUL-779JUL779jul00779
    • 2021-11-22
    29 min

    FC2PPV 2455384 Last 100! "# 11-2" Local Beautiful Milk Music College Student. She Exposes Her Abomination With Blindfold + Handcuffs Play. Creampie While Stripping White Eyes ♡ Facial Expression Moe ♡

  • amateur uncensoredfc2
    • 2021-11-30
    241 min

    [RD-1090]Mature Woman Sex Drama Complete Collection Athena Erotica 10 Men Four Hours "Forgive Me Already!"

  • amateur censoredmarried womanmature womanRDatena eizouRD-1090RD1090
    • 2021-12-04
    126 min

    [GVH-325]Breaking In An Honor S*****t - Obscene Female Pregnancy Training Camp - Hana Momose

  • white peach censoredcreampieschoolgirlGVHglory questkimura hajimeGVH-325GVH325gvh00325



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored