humiliation censored jav javcensored various occupations




FC2DASDROYDSSNIGMEMJUFEVENUHODVADNNGODAUKGAUKSSQTEAWDMILKPPPDMARAHDKACAWDSSISBLK

2020-12-10
244 min

[EQ-537]Bringing Home College Girls For Raw Anal Pounding! 4 Hour Special

  • censoredbig titsamateurEQbullittimpulseEQ-537EQ537h-100eq00537
    • 2020-12-10
    94 min

    FC2PPV 1600511 039 [12 Dopyu Massive Facials] Will JD4, who is about to graduate from college, climb the adult stairs toward working adults？

  • amateur uncensoredfc2
    • 2020-12-12
    63 min

    H0930 ki201212 Gold Pack 20years old

  • amateur uncensoredh0930
    • 2020-12-18
    39 min

    [BTH-100]Make Me Cum By Throatfucking Me - Maina Yuna

  • yuuri censoredbeautiful girlBTHchobitchchovicBTH-100BTH100h-1435bth00100
    • 2020-12-24
    113 min

    [JRZE-016]Entering The Biz At 50! Ran Mizawa

  • ran misawa censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-016JRZE016h-086jrze00016
    • 2021-01-01
    83 min

    259LUXU-1368 Luxury TV 1347 Beautiful beauty salon owner is here! A lustrous body with a thorough sense of beauty transforms into a frustrated body in busy days. Although he shows tension and embarrassment to the big cock that he saw for the first ti

  • amateur censoredamateurluxuluxu-1368luxu1368259luxu-1368
    • 2021-01-05
    60 min

    10musume 010521_01 I longed to read the restraint play of porn books for the first time in junior high school UEMOTOYURI

  • amateur uncensored10musume
    • 2021-02-04
    73 min

    200GANA-2430 Seriously Nampa, first shot. 1592 An elegant and glamorous beauty with a packer on the chest! A beautiful witch who has too many secrets is hard to wash in sex and puts out herself! ？？ Get drunk with the bewitching and elegant Karami!

  • amateur censoredbig titsamateurganagana-2430gana2430200gana-2430
    • 2021-02-06
    54 min

    H0930 ki210206 Requested work

  • amateur uncensoredh0930
    • 2021-02-08

    FC2PPV 1678092 [Amateur] Necafe sex in uniform with Twitter back dirt girls [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-13
    47 min

    188HINT-0438 Hisae

  • amateur censoredmarried womanamateurhinthint-0438hint0438188hint-0438
    • 2021-02-13
    109 min

    240TOKYO-408 Yuuka

  • amateur censoredbig titsamateurtokyotokyo-408tokyo408240tokyo-408
    • 2021-02-25
    160 min

    [MILK-103]Ami Kasai, Complete Combustion. I Am Retiring From Being An AV Actress.

  • kami ami censoredbig titssingle workMILKmilkMILK-103MILK103h-1240milk00103
    • 2021-02-27
    150 min

    [WAAA-036][A Woman Dominated With Acme] Hunting Girls in Uniform Lesbian Massage Parlor Tsubomi

  • bud censoreduniformlesbianWAAAwanz factorywanzWAAA-036WAAA036waaa00036
    • 2021-03-04

    FC2PPV 1710558 Limited number [Uncensored] Night aquarium date with nursery teacher and continuous vaginal cum shot (88 minutes)

  • amateur uncensoredfc2
    • 2021-03-04
    58 min

    FCP-002 [Delivery only] Completely subjective! !! G cup or more that completely wraps Ji ● Ko … Superb big tits fucking ＃ 2

  • amateur censoredbig titsamateurfcpfcp-002fcp002fcp-002
    • 2021-03-06
    92 min

    FC2PPV 1713086 Limited to 200 pieces, 2480 PT! [No individual shooting, miracle appearance beauty, full-scale blowjob, challenge the limit! Non-stop 3 barrage cum swallowing] Eimi-chan, a beautiful woman with a long tongue and god tech that can only

  • amateur uncensoredfc2
    • 2021-03-11
    41 min

    FC2PPV 1721029 * None * First shot! !! Big Breasts H Cup ☆ Celebrity Married Woman Marin (25) Living in Minato Ward Finally Debuts Raw Saddle In The Third Year Of Sexless ♡ Luxury Review Benefits Available

  • amateur uncensoredfc2
    • 2021-03-12
    71 min

    326URF-057 [Back customs] [Furious 4 consecutive shots] [G milk & Kamijiri’s Echiechi ultimate evolution BODY] The ejaculation tech that swings all the ability values erotically is amazing! Ejaculation in the mouth, handjob, facial cumshots,

  • amateur censoredcreampieamateururfurf-057urf057326urf-057
    • 2021-03-13
    60 min

    HEYZO 2478 Deep Kiss, Furious Sex -Make Me Wet- – Miyu Morita

  • miyu morita uncensoredcreampieheyzo
    • 2021-04-10
    44 min

    H4610 ki210411 Ayumi Nakamura 24years old

  • amateur uncensoredh4610
    • 2021-04-18
    128 min

    [BLOR-167]This Natural Airhead Girl Works At An Izakaya Bar And Laughs Like Crazy When I Slowly Work My Way Over Her Body, Her Smile Froze ... And Now She's Downfallen Into Sobbing Orgasmic Despair After Getting Fucked With My Big Cock!

  • censoreddeepthroatBLORbroccoli mousouzokubroccolibroccoliBLOR-167BLOR167blor00167
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-29
    62 min

    [042921_001]M痴女 与田知佳

  • amateur uncensored1pondo
    • 2021-05-01
    171 min

    [NKKD-208]This Is The Story Of How My Wife (28 Years Old) Got Fucked By A Part-Time Worker (20 Years Old, And A Cherry Boy) At Her Part-Time Job ... And I'm So Frustrated That I'd Like To Sell This Footage As An Adult Video (The Hunting Cherr

  • censoredslutNKKDjet eizomanji groupNKKD-208NKKD208nkkd00208
    • 2021-05-02
    133 min

    [MKON-051]The Story Of How My Beloved Girlfriend Cheated With Her Pushy, Athletic Boss Hinako Mori

  • hinako mori censoredcreampiecosplayMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-051MKON051mkon00051
    • 2021-05-07
    195 min

    [SW-773]I Went To My Class Reunion And Saw My First Love For The First Time In 10 Years, And Now She Was A Married Woman With A Voluptuously Sexy Body! Her Husband Had Been Neglecting Her, And She Was Super Horny, So We Fucked In The Hallway, In The

  • censoredSWswitchyocchanswitch switchSW-773SW7731sw00773
    • 2021-05-22
    175 min

    [DGCEMD-012]*Delivery Only! Bonus Video Included *First Lesbians Unleashed! When Aya Shiomi Got Some Hard Lesbian Training From Rena Aoi

  • aya shiomi blue censoredlesbianmature womanDGCEMDcelebrity friendsDGCEMD-012DGCEMD012dgcemd00012
    • 2021-05-31
    66 min

    SIRO-4541 [First shot] [Mochi skin x huge breasts JD] [Waist moves ..] A shy and serious music college student has natural huge breasts. Sensitive she who moves her waist freely when she feels comfortable .. AV application on the net → AV experience

  • amateur censoredbig titsamateursirosiro-4541siro4541siro-4541
    • 2021-06-17
    110 min

    [NCYF-011]A Serious Five-Way Large Orgies Fuck Fest! Meet A Beautiful Girl Cosplayer Who Stands 130cm Tall And Has A Teeny Tiny Body! "You're Going To Break My Pussy!" We're All Taking Turns Shoving Our Big Fat Cocks Into Her Tiny Rig

  • censoredcreampiesquirtingNCYFall japan amateur photographers union daudagawaNCYF-011NCYF011ncyf00011
    • 2021-07-07
    83 min

    469G-648 Imadoki Girls’ Yen Exchange (Daddy Activity) Circumstances! Flower

  • amateur censoredcreampiebig titsgg-648g648469g-648
    • 2021-07-08
    152 min

    [MIST-343]Nipple Madness Tokyo Nipple Girl Who Can Control Your Maximum Pleasure With Her Skilled Nipple Fondling Techniques That Make You Cum, Squirt, And Have A Dry Orgasm Rena Aoi

  • blue censoredcreampiesquirtingMISTmr michirurassha miyoshiMIST-343MIST3431mist00343
    • 2021-07-10
    130 min

    [BADA-017]Married Woman Masochist Training Club Akari Niimura

  • akari shinmura censoredsingle workbukkakeBADAbaltanusubashisuidiamondBADA-017BADA017bada00017
    • 2021-07-14
    132 min

    [HUNTB-054]2 Minutes After Things Get Started, This Slick And Slippery Braless Girl (In A See-Thru Outfit And Known To Be A Hot And Erotic Good Time) Will Tease And Tweak Your Cock And Nipples With An Oil Massage At This Underground Men's Massage

  • censoredHUNTBhuntermasanorihhh groupHUNTB-054HUNTB054huntb00054
    • 2021-07-17
    77 min

    355OPCYN-169 Riina Asuka Riina

  • amateur censoredcreampiebig titsopcynopcyn-169opcyn169355opcyn-169
    • 2021-07-17
    235 min

    [HMN-017]Meeting Up With My Favorite Fuck Buddy for the First Time in 3 Years, Hottest Slut Ever...Fucked Her from Noon to Sunrise and Ended Up Giving Her Creampies. Akari Mitani.

  • mitani akari censoredcreampiebeautiful girlHMNhon nakabacon tanakaHMN-017HMN017hmn00017
    • 2021-07-21
    56 min

    FC2PPV 1934572 18 Year Old Honor Student. 148 Cm Dedicated Basketball Manager. Skillfully Deceived By Words And Thrust Into A Raw Penis, A Large Amount Of Rich Sperm Is Fired In The Mouth!

  • amateur uncensoredfc2
    • 2021-07-23
    192 min

    [YRLL-005]The Two Female Office Workers With The Beautiful Legs: They Are Lesbians Who Love To Lick Their Slutty-Smelling Pantyhoses. Alice Otsu, Ayaka Mochizuki

  • otsu alice ayaka mochizuki censoredlesbianslutYRLLyuriecchi daydreamersgoro koenjimaniac lesbian lickingYRLL-005YRLL005yrll00005
    • 2021-08-06
    118 min

    [EBOD-847]Shacking Her Rare Bell Type Tits And Sucking The Hell Out Of Them. J Cup Delicate Mega-Tits Special Alice Kisaki

  • kisaki alice censoredbig titssquirtingEBODe bodyasagiri jouEBOD-847EBOD847ebod00847
    • 2021-08-12
    107 min

    [ZEAA-064]Blond Wife Is A Masochist-Karina Nishida

  • nishida karina censoredcreampiemarried womanZEAAcenter villagemurakithe pole center villageZEAA-064ZEAA064h-086zeaa00064
    • 2021-08-24
    55 min

    HEYZO 2599 Gorgeous Lady Took The Lead In Sex Play! – Mio Futaba

  • mio futaba uncensoredcreampiehandjobheyzo
    • 2021-08-29
    49 min

    292MY-459 Sho Miyoshi 1

  • amateur censoredmarried womanamateurmymy-459my459292my-459
    • 2021-09-18
    137 min

    [GTJ-096]Fisting

  • aya shiomi yui misaki censoredlesbiandeepthroatGTJdogmatohjirogold tohjiro labelGTJ-096GTJ096gtj00096
    • 2021-09-24
    163 min

    [JUL-714]I Want To See That Smile Forever. Yu Hironaka, 28, AV DEBUT Smile That Gets Your Heart And Makes You Want To Fuck Her

  • yu hironaka censoredmature womansingle workJULmadonnamamezawa mametarouJUL-714JUL714jul00714
    • 2021-11-01
    78 min

    444KING-051 Rin (Hasumi Takashi)

  • amateur censoredcreampiesquirtingkingking-051king051444king-051
    • 2021-11-06
    129 min

    [BAEM-014]Super Masochist Woman. It"s Another Day Getting Broken In. Rika Aimi

  • rumi tadami censoredbig titsslutBAEMbarutanusubashi suiemeraldBAEM-014BAEM014baem00014
    • 2021-11-26
    42 min

    FC2PPV 2466653 "No, Raw Vaginal Cum Shot" Reappears! Kaya-San, An Intelligentsia Returnee ❤ Licking Nipples, Rods, Back Muscles, Balls, And Anal With Plenty Of Fun! Show Off Masturbation And Squeeze Raw Semen At The Woman On Top Posture! !! !

  • amateur uncensoredfc2
    • 2021-12-10
    25 min

    FC2PPV 2504474 Appearance! !! Limited Number! [Uncensored] A Fair-Skinned Gcup Beauty With A Beautiful Look And A Fleeting Memory Of A Tropical Island. On An Uninhabited Island With Just Two People … (3 Times Ejaculation Feature Film) This Is He

  • amateur uncensoredfc2
    • 2021-12-18
    135 min

    [GVH-332]Double Big Tits Sluts, Nene Tanaka / Miki Shiraishi

  • nene tanaka miki shiraishi censoredslutbdsmGVHglory questusubashi suiGVH-332GVH332gvh00332
    • 2021-12-18
    120 min

    [KSBJ-172]Adult In The Home - My Brother-in-law And I - Hitomi Hoshitani

  • hitomi hoshitani censoredblowjobsingle workKSBJksb kikaku emmanuellesakura ninKSBJ-172KSBJ172ksbj00172
    • 2021-12-23
    102 min

    [FERA-132]Distressed Old Lady"s Brain Destroying Armpit Hardening. Boy Who Licks It Falls For Her Adult Sex Appeal. Yukari Orihara

  • yukari orihara censoredcreampiemature womanFERAcenter villagekotaro misatorakuenFERA-132FERA132h-086fera00132
    • 2021-12-28
    238 min

    [HHH-253]If I Show A Married Woman Who Brought Me In Nampa, I"m In Heat And I Don"t Need Words ...

  • censoredamateurHHHviptriple hHHH-253HHH25378hhh00253
    • 2021-12-31
    119 min

    [MIAA-555]I Got An Erection When I Saw My C***dhood Friend Who Helps Me Being Fucked By A Bully Luna Tsukino

  • tsukino luna censoredcreampieschoolgirlMIAAmoodyzzack araiminna no kikatanMIAA-555MIAA555miaa00555
    • 2022-01-01
    130 min

    [XVSR-628]Unlimited Squirting And Golden Shower Mega Splash. Mizuki Sakino

  • mizuki sakino censoredsquirtingsingle workXVSRmax asono kancalenXVSR-628XVSR628xvsr00628
    • 2022-01-13
    115 min

    [SDMU-974]人気同人サークル初コラボ おすゆり出版×SOFT ON DEMAND 男の娘×男の娘!？おすゆり恋愛ドキュメント

  • amateur censoredSDMUsodSDMU-974SDMU974
    • 2022-01-14
    50 min

    417SRYA-015 [Sperm-Loving Gal X Ozashiki Oops Pub] Beautiful Breasts Of The Most Popular Beauty! Random Paripi Sex That Comes To Saddle With Glue! Beroma Co ○ Is Also The Best!

  • amateur censoredamateurslutsryasrya-015srya015417srya-015



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored