incest mature woman housewife javcensored jav




FC2KSBJRBDDASDJULAUKGHMNSANCAWDSQTENACRATIDAWDVENXHZGDLULUPREDHUNTBSSNIABWKBI

2020-11-13
117 min

[HERY-107]Turning A Man's Daughter Into A Complete Slut Collection 5 - Komachi Akitsu

  • akitsu komachi censoredcreampiedeepthroatHERYyellow mousouzokudr fuyellowHERY-107HERY107hery00107
    • 2020-11-14
    129 min

    [ARM-922]Cocks Rubbed On The Soles Of Feet - The Ultimate Erotic Oil Massage

  • censoredhandjobARMaroma planningshigeo kadowakiaromaARM-922ARM922arm00922
    • 2020-11-26
    76 min

    432YKMC-041 Yume

  • amateur censoredcreampiebig titsykmcykmc-041ykmc041ykmc-041
    • 2020-12-01
    78 min

    200GANA-2382 Seriously Nampa, first shot. 1562 [Autumn of appetite! Autumn of sex! ] I invited a nurse who wants a man to Tacopa and tried it! Plenty of huge breasts and hairless ma ● Ko is about to eat now! Drip thick man juice and taste the man aft

  • amateur censoredbig titsamateurganagana-2382gana2382200gana-2382
    • 2020-12-13
    119 min

    [NSPS-951]This Young Wife And A Loser Old Man Are Making Love Without Any Time To Spare "Creampie Sex" - I Was Secretly Involved With The Young Wife From Next Door, And Those Memories Of Summertime Were Like A Dream Cum True For Me - Ena Koum

  • ena koume censoredcreampiemature womanNSPSnagae stylejotaro tomiNSPS-951NSPS951nsps00951
    • 2020-12-18
    106 min

    [MBDD-2048]Kanon Kawase In The Panty Diary

  • kanon kawase censoredbeautiful girlsingle workMBDDmedia branduniform gravureMBDD-2048MBDD2048301mbdd02048
    • 2020-12-18
    240 min

    [MBM-244]Luxury Eros Company Neat And Clean, Elegant Mature Woman Celebrity Babes We Seduced Them And Brought Them Home 12 Ladies 4-Hour Special 05

  • censoredamateurmature womanMBMprestigegaro sasazukambmMBM-244MBM244118mbm00244
    • 2021-01-16
    119 min

    [SSNI-972]She Came So Hard She Pissed Herself! But The Guy Just Kept Railing Her! Her First Ever Pissing Sex Izuna Maki

  • izuna maki censoredsquirtingbeautiful girlSSNIs1 no 1 stylesuisei akaiSSNI-972SSNI972ssni00972
    • 2021-01-21
    43 min

    FC2PPV 1654047 [First shot] Imadoki JD ♥♥ who is curious and loves H Pien rushes in a rainy day happening …

  • amateur uncensoredfc2
    • 2021-01-23
    240 min

    [JKSR-479]@Shinjuku - Rural Wives Only - Picking Up Girls At The Bus Terminal Who've Got Reasons To Cheat 12 Girls, 4 Hours

  • censoredamateurbeautiful girlJKSRbig morkalobockeyprink junkyJKSR-479JKSR47957jksr00479
    • 2021-02-04
    64 min

    336KNB-140 I want money to build a house and apply for AV! A sexually active wife who is not satisfied with having sex with her husband every day is urged by a crazy look. I will take a gonzo with this married woman from now on. 35 at Negishi Station

  • amateur censoredbig titsmarried womanknbknb-140knb140336knb-140
    • 2021-02-05
    75 min

    FC2PPV 1667679 ＃ 52 Tin A little awkward Icharab sex with Gundam picked up at Comiket and Aniota who likes vaginal cum shot [First shot] [Personal shooting] [Gonzo] [High quality]

  • amateur uncensoredfc2
    • 2021-02-07
    121 min

    [LUKE-012]Slut Stepsister Who Tempts Me With Dirty Words Up Close To Me - Natsu Nishida

  • natsu nishida censoredslutlingerieLUKEdigital arkdigital ark digital arkLUKE-012LUKE012luke00012
    • 2021-02-09
    60 min

    FC2PPV 1679338 ★ First shot amateur ☆ Active JD’s big pie Pochakawa ♥ Ringo-chan 20 years old ☆ G cup huge breasts erotic girl ♥ Super erotic rich blowjob ♥ The best pussy ever! Tokuno Creampie ♥ [Personal shooting] * With benefits

  • amateur uncensoredfc2
    • 2021-02-12
    129 min

    [ABW-056]Creampie: Fuck As Much As You Want 8 - Ako Shiraishi

  • akiko shiraishi censoredcreampiesingle workABWprestigeitoman akifumiabsolutely wonderfulABW-056ABW056118abw00056
    • 2021-02-26
    92 min

    SNYZ-020 Aria-chan 2

  • amateur censoredamateurcosplaysnyzsnyz-020snyz020snyz-020
    • 2021-02-27
    118 min

    [MIMK-085]Having Sex With My Super Capable Married Female Coworker On Our Business Trip! She's Always Really Serious And Scary But This Time She's Just A Woman - JULIA

  • julia censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-085MIMK085mimk00085
    • 2021-03-01
    58 min

    324SRTD-0215 She volunteered for SEX with big breasts and the highest sensitivity of God’s milk sister!

  • amateur censoredbig titsamateursrtdsrtd-0215srtd0215324srtd-0215
    • 2021-03-03
    39 min

    S-Cute if_016_06 She wants to spear / Chiharu

  • chiharu censoredamateurdramaifif-016if016if-016-06
    • 2021-03-06
    138 min

    [JBD-264]Specially Selected Women - Walkure Of The Abyss - Akari Niimura

  • akari shinmura censoredsingle workJBDattackersnaoyuki kubojabakuJBD-264JBD264jbd00264
    • 2021-03-06
    60 min

    200GANA-2442 Seriously Nampa, first shot. 1606 Call out to a female college student who lacks sleep, Why don’t you try a good sleep pillow？ ⇒ Hotel IN! The pillow becomes an actor’s arm pillow before you know it! The humble girl is complete

  • amateur censoredamateurganagana-2442gana2442200gana-2442
    • 2021-03-07
    181 min

    [MEAT-029]A Limber Body x Colossal Tits x A Huge Ass This Voluptuous Girl Is Begging To Appear In This Adult Video! 3 Sweaty, Big Dick Fucks

  • censoredbig titsamateurMEATbig fleshy road family daydreamMEAT-029MEAT029meat00029
    • 2021-03-10
    96 min

    435MFC-087 Slender small breasts girl who works for cheating SEX [Shiroto Gonzo ＃ Miumi ＃ 24 years old ＃ B cup (flight attendant)]

  • amateur censoredcreampiesquirtingmfcmfc-087mfc087435mfc-087
    • 2021-03-18
    45 min

    FC2PPV 1731430 [Amateur individual shooting] It was the best time to meet a blame-loving slut on a dating app. There is a second round of raw squirrel [Supporting personal shooting [No.48]] [Review privilege: Another angle]

  • amateur uncensoredfc2
    • 2021-03-29
    71 min

    469G-639 Imadoki Girls’ Circle Exchange (Daddy Activity) Circumstances! Narumi

  • amateur censoredcreampieuniformgg-639g639469g-639
    • 2021-03-29
    66 min

    402MNTJ-049 Shoko

  • amateur censoredamateurmntjmntj-049mntj049402mntj-049
    • 2021-04-17
    163 min

    [CJOD-292]Surrounded By A Triple Slut Threat - S********ls Take Advantage Of Their Teacher After School At A Love Hotel For Creampie Sex. Ichika Matsumoto Rei Kuruki Mitsuki Nagisa

  • ichika matsumoto satoshi kuruki censoredcreampieschoolgirlCJODchijo heavensapporo taroCJOD-292CJOD292cjod00292
    • 2021-04-18
    126 min

    [AGAV-053]Nympho Step Sisters # 2 ~ Big Titty College Girl Step Sisters Share Dick For Fun ~

  • miki sanada miki sanada mizuki sanada mai takeda censoredbig titsbeautiful girlAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-053AGAV053agav00053
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-05
    100 min

    355OPCYN-166 Nozomi

  • amateur censoredcreampiemarried womanopcynopcyn-166opcyn166355opcyn-166
    • 2021-05-08
    135 min

    [NSPS-991]あなたの嫌うあの人と 町の権力者に抱かれた私の妻 向井藍

  • ai mukai censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-991NSPS991nsps00991
    • 2021-05-14
    180 min

    [SSIS-069]*Completely Uned! POV! No Make Up! Anything Goes! How Izuna Maki Really Likes To Fuck - Her Real Carnal Instincts Exposed! Hard Sex On A Couple's Hot Spring Trip With Fresh, Exciting, Ultra-Rare 200 Erotic Footage

  • izuna maki censoredsingle workSSISs1 no 1 styleSSIS-069SSIS069ssis00069
    • 2021-05-14
    116 min

    [SSIS-072]Even Though She Is Screaming So Hard As To Tear Out Her Throat, Her Squirting Climax Doesn't Stop: Siren Splash Rough Fuck: Mai Shiomi

  • mai shiomi censoredsquirtingbeautiful girlSSISs1 no 1 stylegoemonSSIS-072SSIS072ssis00072
    • 2021-05-21
    115 min

    [NNPJ-449]Tokyo Sugar Babies Fucking Super Cute Girls In School Uniforms Sensitive S********l Nacchan

  • censoredcreampieuniformNNPJnanpa japanNNPJ-449NNPJ449nnpj00449
    • 2021-06-04
    51 min

    520SSK-004 Akari

  • amateur censoredcreampiebig titssskssk-004ssk004520ssk-004
    • 2021-07-02
    120 min

    [JUL-643]I Wanted To Test My Wife's Love For Me, So I Left Her Alone With My Horny Co-Worker, And 3 Hours Later ... He Kept His Dick Inside Her The Entire Time For 16 Creampie Cum Shots, And Took Her Away From Me In This Woeful NTR Tale Reiko Kob

  • kobayakawa reiko censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-643JUL643jul00643
    • 2021-07-09
    151 min

    [EBOD-836]"Aren't Just Boobs Enough？" Shy and Not Good at Talking, But She Came to Tokyo Wanting to Be an AV Actress - Megaton J Cup Barely Legal AV debut Alice Kisaki

  • kisaki alice censoredbig titssingle workEBODe bodymichiru arashiyamaEBOD-836EBOD836ebod00836
    • 2021-07-15
    112 min

    [DDOB-095]Brainwashing so that I Can Come in Her Pussy. Jun Haruaki.

  • jun shunmei censoredcreampiemature womanDDOBdogmatenunmy auntDDOB-095DDOB095ddob00095
    • 2021-07-30
    228 min

    [HUNTB-067]"Step-brother, are you hard？" My first experience with my step-sister who stole my virginity and semen...

  • censoredcreampiesisterHUNTBhunterborubo nakanohhh groupHUNTB-067HUNTB067huntb00067
    • 2021-08-03
    65 min

    422ION-0074 Secret Meeting NTR Gonzo At A Love Hotel With My Sister-In-Law

  • amateur censoredmarried womanamateurionion-0074ion0074422ion-0074
    • 2021-08-08
    14 min

    10musume 080821_01 I’Ll Make You Feel Good By My Mouth, So I Hope This Might Cheer You Up？ Yu Nagata

  • amateur uncensored10musume
    • 2021-09-03
    281 min

    [DVDMS-693]Sex-loving Step-sisters Who Love Raw Sex And Want You To Lick Their Pussies

  • momose asuka mamiya nagi censoredcreampieslutDVDMSdeepsmotofuji peroflavorsDVDMS-693DVDMS693dvdms00693
    • 2021-09-03
    60 min

    FC2PPV 2111805 Fluffy Amateur Jd Misaki Who Doesn’T Think About Anything! When I Took It Off, I Had A Super Dangerous Body! Big Natural Boobs And Amazing Constriction! Miracle! Naturally Vaginal Cum Shot! [Individual Shooting]

  • amateur uncensoredfc2
    • 2021-09-06
    59 min

    FC2PPV 2164638 9/10 Made * 2980⇒1280pt: Since The Loss Of Virginity !! 19 Years Old X D Cup Active Jd Kosuzu ♥ "I Will Bother You" Ubu Daughter With Almost Zero Knowledge & Experience That Has Never Been Grasped By Matomo

  • amateur uncensoredfc2
    • 2021-09-17
    151 min

    [MVSD-478]Super Hardcore 3-hole Gangbag Fuck! Pussy! Throat Cunt! Asshole! A Beautiful Girl In School Uniform Is Fucked In All Her Holes 30 Consecutive Times With Creampie! Elena Takeda

  • elena takeda censoredcreampiebeautiful girlMVSDm s video groupakai suiseims video groupMVSD-478MVSD478mvsd00478
    • 2021-11-05
    207 min

    [HUNTB-136]"I"m Never Satisfied... So... Please..." Sex With Older Step-brother To Conceive Isn"t Satisfying At All, So This Super Hot Sister-in-Law Releases Her Pent-up Frustrations On Her Younger Step-brother For Creampie Fucking.

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-136HUNTB136huntb00136
    • 2021-11-24
    58 min

    10musume 112421_01 I Got Acme Many Times In The Car And I Wanted A Cock Sakie Hayasaka

  • amateur uncensored10musume
    • 2021-12-04
    106 min

    [SQTE-392]Godly Breasts: 102 Centimeters Of Jiggling Fuck - Hana Himesaki

  • himesaki hana censoredbig titsblowjobSQTEs cutes cute s cuteSQTE-392SQTE392sqte00392
    • 2021-12-07
    51 min

    498DDH-051 [The First Men’s Beauty Salon, Where Cute Staff Are In Close Contact With Each Other For Treatment! ] An Older Sister Who Sends An Unpleasant Look To My Erection Irresistibly. With A Serious Face, I’m Completely Playing With My B

  • amateur censoredcreampieamateurddhddh-051ddh051498ddh-051
    • 2021-12-17
    45 min

    FC2PPV 2522099 First Shot! !! Limited Number! [Uncensored] Creampie Twice To A Gorgeous Active Beauty College Student Gcup Beauty With High Pride! !! (Feature Film)

  • amateur uncensoredfc2
    • 2022-01-01
    71 min

    300NTK-680 [Echi Echi Beautiful Breasts Tiger Akeome Sex] [Beauty Layer Princess Beginning Creampie 2nn] [Echiechi Early In The New Year] The Goddess Of Absolute Eros Appears From New Year’s Day! !! Echiechi Exquisite Body To Dress In A Tiger Co

  • olnn censoredcreampieamateurntkntk-680ntk680300ntk-680
    • 2022-01-01
    122 min

    [XVSR-632]Rika Aimi Will Spend The Entire Day, Slowly, Luxuriously, Popping A Cherry Boy"s Cock

  • rumi tadami censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-632XVSR632xvsr00632
    • 2022-01-10
    205 min

    [016HEZ-359]美魔女ナンパ！！HG 歳を重ねるごとに綺麗さと感度が増した熟女にズブリッと挿入 生性交！！ 3

  • amateur censoredcreampiebig titshezhez-359hez359016hez-359
    • 2022-01-11
    95 min

    534IND-020 Active Private Girls ○ Raw _ Virgin Man’s First Gonzo _ Continuous Unauthorized Creampie For An Idol Class Beautiful Girl (Natsu Tojo)

  • amateur censoredcreampieamateurindind-020ind020534ind-020
    • 2022-01-15
    60 min

    C0930 ki220116 Kanae Abe 56years old

  • amateur uncensoredc0930
    • 2022-01-21
    81 min

    [PITV-029]Yui Miyata. Little Egg.

  • miyata yui censoredbeautiful girlsingle workPITVpistilPITV-029PITV0295581pitv00029



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored