incest sister jav high vision censored




FC2MARAVEMABLKJULKSBJFSDSSWAAANACRMIDVSSISCAWDPPPDAMBIKBICESDSDABDASDHNDWANZHDKA

2021-01-17
26 min

FC2PPV 1648553 Celica’s first multiple play 27 minutes

  • amateur uncensoredfc2
    • 2021-01-24
    142 min

    [APKH-162]"I Want To Be Defiled... Please Turn Me Into A Pervert..." This Girl In Uniform Is Cute Enough To Be An Idol, And On Her Way Home From School, She Got Fucked By A Dirty Old Man Old Enough To Be Her Father And He Filmed Her As She We

  • risa shirojo censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-162APKH162apkh00162
    • 2021-01-30
    376 min

    [HMJM-052]Super Best 6 Hours Yumi Saeki

  • yuka saeki censoredbig titssingle workHMJMhmjmcompany matsmaHMJM-052HMJM052h-172hmjm00052
    • 2021-01-31
    88 min

    [EVIZ-069]A Secret Bath Where Girls Get You Off 02

  • natsuki igarashi censoredbig titsblowjobEVIZebisusan mousouzokumad dogEVIZ-069EVIZ069eviz00069
    • 2021-02-03
    63 min

    FC2PPV 1670495 [Personal shooting / set sale] I bought a 30-year-old married woman who had been bred. Complete version

  • amateur uncensoredfc2
    • 2021-02-07
    101 min

    [VENX-003]Family Fun: Bikini Mama Can't Give Up On This Year's Trip To Hawaii... Mako Oda

  • oda mako censoredcreampiebig titsVENXvenuspeterfakecest winntersVENX-003VENX003venx00003
    • 2021-02-07
    140 min

    [PKPL-002]Totally Private Videos The Hot Topic Innocent And Pure, Slender And Beautiful Girl It's Your First Sleepover Date, Alone With Mahiro Ichiki

  • mahiro ichiki censoredcreampiebeautiful girlPKPLfuck group and fun friends daydreamersPKPL-002PKPL002pkpl00002
    • 2021-02-12
    119 min

    [MIDE-881]Cutie With Soft, Curvy, Knock-Out Body Takes On Her First Client At A Soapland Brothel Rei Futami

  • rei futami censoredcreampieblowjobMIDEmoodyzsuisei akaimoodyz divaMIDE-881MIDE881mide00881
    • 2021-02-21
    165 min

    [HND-946]When I Started To Gasp For Air, She Covered My Mouth With Slobbering Kisses And Even When My Cock Started To Bug Out, She Wouldn't Stop Pounding Me With Piston-Powered Creampie Thrusts Because She Was A Kissing Cowgirl Elder Sister Type

  • mitani akari censoredcreampieslutHNDhon nakanao masakiHND-946HND946hnd00946
    • 2021-02-25
    61 min

    1Pondo 022521_001 Browjob and SEX in the Futon: Airi Mikumo

  • amateur uncensored1pondo
    • 2021-03-01
    123 min

    [NACR-399]The Hot Wife Next Door What Happened When She Entered The Wrong House Risa Mochizuki

  • risa mochizuki censoredcreampieslutNACRplanet plusdirector onanakuruNACR-399NACR399h-237nacr00399
    • 2021-03-04
    22 min

    HEYZO 2472 Moe’s Orgasms with Toys – Moe Nashiki

  • moe nashiki uncensoredhandjobheyzo
    • 2021-03-07
    119 min

    SMUK-037 Wan

  • amateur censoredcreampieamateursmuksmuk-037smuk037smuk-037
    • 2021-03-12
    90 min

    [DHT-256]Score A MILF F-Cup With Long, Beautiful Legs In A Miniskirt! Ms Kayo Age 31

  • censoredcreampiebig titsDHThot entertainmentstudio zeroDHT-256DHT25659dht00256
    • 2021-03-13
    160 min

    [EBOD-808]This Girl Works At A Ramen Noodle Shop, And She's Really Good At Draining The Hot Water From The Noodles ... But She's Got A Sensual Body Who Is Massively Squirting When She Has Sex!! A Voluptuous G-Cup Titty Headliner Girl Her Adul

  • aika natsume censoredbig titssquirtingEBODe bodytrendy yamaguchiEBOD-808EBOD808ebod00808
    • 2021-03-14
    42 min

    492MERC-259 After all, erotic is milk. 2

  • amateur censoredcreampiebig titsmercmerc-259merc259492merc-259
    • 2021-03-15
    70 min

    259LUXU-1374 Luxury TV 1378 "I want you to blame me more …" Exotic professional dancers are now on Luxury TV! The stunning proportions trained in daily training and the M temperament hidden inside are exposed in front of the camera, and

  • amateur censoredbig titsamateurluxuluxu-1374luxu1374259luxu-1374
    • 2021-03-20
    241 min

    [MGDN-149]Amateur Girls With No Make Up Only! Can You Seduced These Amateur Girls With Sexy Bodies？ Special

  • censoredamateurMGDNstar paradisemegadonMGDN-149MGDN149h-254mgdn00149
    • 2021-03-23
    165 min

    FC2PPV 1737461 32: [Individual shooting] Classmate of the metropolitan commercial department, support for girls with big breasts [4K image quality 60fps]

  • amateur uncensoredfc2
    • 2021-03-26
    150 min

    [ID-010]Video Of Women Doing Dirty Things For Me On The Way To Work Rei Kuruki / Nono Yuki / Natsu Tojo

  • azuki airi sato censoredcreampiebig titsIDtmaID-010ID0105525id00010
    • 2021-04-08
    240 min

    [SVDVD-851]Girl Gets Horny From Aphrodisiac And Gets Her G-Spot Ravished With A Penis Ring! Lust Explosion Overdrive

  • censoredcreampiesquirtingSVDVDsadistic villagejiro tsubuyakiamateur back sadistic villageSVDVD-851SVDVD8511svdvd00851
    • 2021-05-02
    86 min

    [VENX-032]This Horny Stepmom Started Lusting For Her Stepson's Morning Wood, So She Mounted Him Without Permission And Started Grinding Him With Cowgirl Sex Until She Came Karina Ayami

  • karina ayamizu censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-032VENX032venx00032
    • 2021-05-02
    100 min

    [VENX-033]Step Mother And Step Son Start Fucking 2 Seconds After Step Father Leaves The House Sakura Tsukishima

  • tsukishima sakura censoredcreampiebig titsVENXvenussarufakecest winntersVENX-033VENX033venx00033
    • 2021-05-18
    62 min

    SIRO-4469 [First shot] [Fair-skinned beautiful breasts JD] [Climax of the abyss] Neat and clean beautiful breasts JD that is weak against pushing. Exploding her sullen propensity and shaking her natural breasts, she goes into a deep and deep orgasm v

  • amateur censoredamateursirosiro-4469siro4469siro-4469
    • 2021-05-31
    123 min

    241GAREA-518 Ai

  • amateur censoredamateurbeautiful girlgareagarea-518garea518241garea-518
    • 2021-06-05
    242 min

    [MMB-370]Filthy Wives Can't Keep Their Legs Shut 10 Married Women Lusting After Cock Get Fucked

  • censoredmature womanslutMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-370MMB370mmb00370
    • 2021-06-16
    54 min

    FC2PPV 1872413 Up to 23 2480 [No] Miss Con tall beauty pageant. She teases her slender limbs until she feels like it, and vaginal cum shot without permission.

  • amateur uncensoredfc2
    • 2021-06-19
    70 min

    200GANA-2510 Seriously Nampa, first shot. 1650 "Longing for City Girl …" Bring the up-and-coming man who has just come to Tokyo to the hotel! A beautiful girl who has been baptized in the city leaks the tide and her breath constantly tre

  • amateur censoredsquirtingamateurganagana-2510gana2510200gana-2510
    • 2021-06-26
    61 min

    HEYZO 2553 Sex Heaven -Naughty Prank On Nana- – Nana Nanami

  • nana nanami uncensoredcreampieheyzo
    • 2021-07-08
    48 min

    FC2PPV 1911064 [Rare item] Beautiful athlete outflow ③ Face and milk are amazing

  • amateur uncensoredfc2
    • 2021-07-08
    45 min

    FC2PPV 1911827 [No] [Appearance] [ASMR Review Benefits] BOF New Project! Chibi gal and transformation play in a slimy lotion bath ♡ First time 50 1980pt ☆

  • amateur uncensoredfc2
    • 2021-07-10
    131 min

    [EKDV-662]A Fresh Face Maid Who Came With Hope in Her Chest is Seeded From Morning Till Night in Spastic Breaking In. Being Fucked So Much That I Want to Cry By a Man Who Feels Only Hate... Hana Shirato

  • white peach censoredcreampiedeepthroatEKDVcrystal eizoe kissEKDV-662EKDV662ekdv00662
    • 2021-07-14
    54 min

    494SIKA-097 A Natural Makeup Beautiful Girl Who Wants To See A Naughty Appearance 3P

  • amateur censoredschoolgirlamateursikasika-097sika097494sika-097
    • 2021-07-14
    204 min

    [HUNTB-061]"If You Keep Pounding Me Like This I'm Going To Lose It!" Virgin Cherry Boy Has It Popped By His Slutty Stepsister And Drives Her To A Real Orgasm! Pinned With Her Tight Legs Wrapped Around Him...

  • censoredcreampieschoolgirlHUNTBhuntermorikihhh groupHUNTB-061HUNTB061huntb00061
    • 2021-08-06
    58 min

    230OREC-835 Hot Spring Slut Private College Student HRS

  • amateur censoredcreampieamateurorecorec-835orec835230orec-835
    • 2021-08-07
    168 min

    [MDTE-013]The Beautiful Y********l In Uniform Gives Handjobs and Blowjobs to 28 People, 165 Minutes

  • mao watanabe moe hazuki censoredschoolgirlblowjobMDTEk m produceuchuu kikakuMDTE-013MDTE013mdte00013
    • 2021-08-20
    230 min

    [HNDS-071]Why Not Fuck Us Until Morning! A Crazy Night Of Creampie Sluts!! Squirting, Swallowing, Anal, Female Orgasm, Pee, Anything Goes At This Harlem Fuck Party Full Of Nonstop Cumshots !! Mao Hamasaki Kaho Imai Yuri Fukada Azusa Misaki Mitsuki Mi

  • hamazaki mao natsuho imai censoredcreampieslutHNDSbooknanzaki masakiHNDS-071HNDS071hnds00071
    • 2021-08-21
    61 min

    1Pondo 082121_001 I Will Teach You How To Handle The Cock In Practice! Kurumi Kokoro

  • amateur uncensored1pondo
    • 2021-09-24
    139 min

    [JUL-711]A Super-Anticipated, Massive Exclusive From The Madonna Label, No.2!! Passionate Sex, So Hot It Will Make You Lose Your Mind, And Make You Lose Your Memory. The Genius Of All Geniuses, Finally Awakens. Minami Yasu

  • minami ahn censoredmature womansingle workJULmadonnamamezawa mametarouJUL-711JUL711jul00711
    • 2021-10-04
    107 min

    FC2PPV 2295656 Wrestling Mask Men’s Esthetic Technique Collection Vol.29

  • amateur uncensoredfc2
    • 2021-10-06
    52 min

    229SCUTE-1134 Mahiro (25) S-Cute Black Hair Uniform Girl’s Creampie Etch (Mahiro Ichiki)

  • amateur censoredamateurbeautiful girlscutescute-1134scute1134229scute-1134
    • 2021-10-15
    147 min

    [MIRD-214]A Golden Shower Harlem I Want These 4 Beautiful Girl Babes To Spray Me With Their Piss And Make Me Cum, Over And Over Again! Runa Tsukino Asuka Momose Yui Nagase Hikaru Minazuki

  • tsukino luna momose asuka censoredcreampiesquirtingMIRDmoodyzdoragon nishikawamoodyz realMIRD-214MIRD214mird00214
    • 2021-10-18
    125 min

    [FTDSS-006]True Raw-Fuck Documentary. Stuck In a Love Hotel For One Whole Day With a Perverted Old Guy...Filthy and Crazy Creampie Intercourse Yoko Tsukasa

  • yoko tsukasa censoredcreampieFTDSSfalenoyamaguchi memberfaleno tubeFTDSS-006FTDSS0061ftdss00006
    • 2021-10-22
    119 min

    [DASD-928]Brainwashed Into Thinking It Was The End Of The World, I Let Them Keep Me Locked Up. Kotone Toa

  • toua kotone scooping censoredcreampiebeautiful girlDASDdasinugami ryouDASD-928DASD928dasd00928
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-05
    122 min

    [NDRA-092]My Girlfriend Doesn"t Know But I"m Doing Her Mother Too... Iroha Narimiya

  • narumiya iroha censoredbig titsmature womanNDRAjet eizougroupNDRA-092NDRA092ndra00092
    • 2021-11-10
    71 min

    533NNS-016 P Geki Ubu Ascension Of A Live Virgin! !! Creampie Video Leaked To Pichi Pichi Ma ○ Ko! !! Keiren Vaginal Cowgirl That Induces Continuous Squeezing With Almost No Experience … Winner! !!

  • amateur censoredcreampiebig titsnnsnns-016nns016533nns-016
    • 2021-11-10
    38 min

    FC2PPV 2417378 First Appearance! !! Limited Number! [Uncensored] Absolute Area Of Teenagers Seen On The Platform Of The Station! Innocent Schoolgirl Like A Kitten Is Brought Into A Closed Room And Vaginal Cum Shot! !!

  • amateur uncensoredfc2
    • 2021-11-18
    52 min

    FCP-054 [Delivery Only] Your Ji-Po Will Definitely Be Pulled Out …! Beautiful Girl Handjob! << Completely Subjective >> 4 (Rei Futami Nagi Kamo Minon Aisu)

  • amateur censoredamateurbeautiful girlfcpfcp-054fcp054fcp-054
    • 2021-12-03
    151 min

    [MIFD-189]A Fresh Face A Real-Life, Tall And Slender Lifeguard With Beautiful Legs And A Slender Body Wants To Have Sex So Badly, She"s Making Her Adult Video Debut!! Miki Tamashiro

  • miki tamaki censoredblowjobsingle workMIFDmoodyztorendei yamaguchimoodyz freshMIFD-189MIFD189mifd00189
    • 2021-12-10
    65 min

    529STCV-041 Mika

  • amateur censoredcreampiebig titsstcvstcv-041stcv041529stcv-041
    • 2022-01-08
    154 min

    [MKMP-433]Famous Socialite Wives With Too Much Free Time And Their Adulterous Harem

  • otsuki sound shinoda yu censoredcreampieslutMKMPk m producerakudamillionMKMP-433MKMP433mkmp00433
    • 2022-01-24
    115 min

    [AKDL-164]"For Your Sake, I"ll Go And Sleep With Your Boss For Just One Night." Rino Yuki.

  • yuki rino censoredcreampiebig titsAKDLakinoriakinoriaknrAKDL-164AKDL1641akdl00164
    • 2022-01-27
    169 min

    [SW-827]Natsu, A Flirtatious S********l Daydream. A Beautiful Girl In Class Is Still Naive And Tells Her Teacher How Much She Loves Him! She Has The Face Of An Idol And A Slender Body, And Now She"s Mine! Natsu Tojo

  • natsu tojo censoredschoolgirlblowjobSWswitchlight fujimaswitch switchSW-827SW8271sw00827
    • 2022-01-29
    280 min

    [NKD-287]Sex Toy Instinct - Perverted Habits Selection

  • censoredNKDnakashima kougyouNKD-287NKD287nkd00287
    • 2022-02-04
    64 min

    230OREC-1004 Yu-San, 31 Years Old (Yu Hironaka)

  • amateur censoredcreampiemarried womanorecorec-1004orec1004230orec-1004



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored