jav beautiful girl javcensored facial cumshot pov




FC2NATRMILKVEMAMEYDFSDSSMVSDCESDMARACAWDATIDADNVENUNACXGMEMJUFEWAAASQTECHRVDASDJUL

2020-09-21
126 min

[OPPW-071]In Shock After I'm Dumped By My Lesbian Girlfriend I Decide To Become A Cross Dresser Namie Shiraishi

  • namie shiraishi censoredanalsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-071OPPW071oppw00071
    • 2020-09-24
    55 min

    [SIROR-029]The Work Of A Mature Woman For Rent - The Secret Side Of A Wife That Her Husband Will Never See - FILE NO.29

  • censoredcreampiebig titsSIRORamateur dispatch.comSIROR-029SIROR029h-1492siror00029
    • 2020-10-03
    120 min

    [JUL-340]I Returned Home To Visit My Family, And My Big Stepsister Lured Me Into Sweaty, Creampie Impregnation Sex Aoi Mukai

  • ai mukai censoredcreampiemarried womanJULmadonnakitorune kawaguchiJUL-340JUL340jul00340
    • 2020-10-06
    63 min

    FC2PPV 1525132 [Individual] A 50-year-old mature teacher related to her students. Teacher disqualification Gonzo who becomes obedient and gets wet in the crotch without complaining to the students who are in a good condition [First special price]

  • amateur uncensoredfc2
    • 2020-10-10
    145 min

    [EBOD-768]She's Lifting Her Creampie Ban! A 2-Day, 1-Night, 10 Ejaculation Orgasm Creampie Sex-Filled Vacation With A Horny Old Man And His Raw Cock Rina Asuka

  • asuka riina censoredcreampiebig titsEBODe bodytake dEBOD-768EBOD768ebod00768
    • 2020-10-25
    138 min

    [CEAD-320]Super Perverted Mature Ladies AV Debut! First 3P X Creampie Raw Footage!! Hitomi Hitachi

  • hitachi hitomi censoredcreampiemature womanCEADceleb no tomoCEAD-320CEAD320cead00320
    • 2020-10-30
    484 min

    [EQ-532]Picking Up Real Amateurs, Big Titted Wives, 8 Hours 01

  • censoredcreampiebig titsEQbullittburittoEQ-532EQ532h-100eq00532
    • 2020-11-09
    11 min

    FC2PPV 1563737 [Personal shooting] Ayane 22 years old Blow & Handjob Remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2020-11-17
    23 min

    FC2PPV 1572752 * No resale 4800pt → 1800pt [No face moza limited to the first 100 people] Creampie appearance leaked due to the debt of the local beauty OL who was selected for the town beauty contest

  • amateur uncensoredfc2
    • 2020-11-20
    54 min

    FC2PPV 1561487 [Limited quantity 2980pt → 1980pt] Summer memories: Shinobi hot spring date ❤️ Love love hot spring date in plain clothes ❤️ Yuka who changed into a yukata and all-you-can-suck pink nipples in a private hot spring ❤️ Purchase privilege

  • amateur uncensoredfc2
    • 2020-12-05
    50 min

    1Pondo 120520_001 Braless Neighbor In The Morning: Kanae Murakami

  • amateur uncensored1pondo
    • 2020-12-16
    125 min

    [GVH-164]Naughty Nurses - Nene Tanaka

  • nene tanaka censoredcreampiegrandfatherGVHglory questmametaro mamezawaGVH-164GVH16413gvh00164
    • 2020-12-20
    136 min

    [HND-921]She's Fucked 300 Guys In Chiba Alone! Super Sexy Tanned Slut Wants To Make Memories By Taking Your Creampie - Her Porn Debut Rio Sakune

  • sakune rio censoredcreampiesingle workHNDhon nakamametaro mamezawaHND-921HND921hnd00921
    • 2020-12-21
    56 min

    10musume 122120_01 Preparedness of Pregnancy Creampie With Santa Cosplay Hitomi Ikeda

  • amateur uncensored10musume
    • 2020-12-25
    240 min

    [MBM-253]Fertilize! Heaven's Shame For Cheating Wives! 12 Married Women 4 Hours Of Eating Evil Creampies With Adulterous Sex Betraying Their Husbands

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-253MBM253118mbm00253
    • 2020-12-31
    100 min

    AVKH-190 Mashima Aya

  • amateur censoredamateuravkhavkh-190avkh190avkh-190
    • 2021-01-02
    78 min

    [IMPNO-028]Innocent Anguish Mont Blanc/Ran

  • censoredanalIMPNOimpactnon label impactIMPNO-028IMPNO028h-1154impno00028
    • 2021-01-04
    60 min

    SIRO-4379 [First shot] [Shortcut beauty] [Beauty member panting indecently] A slender girl who applied for stress relief. Don’t miss the moment when the shy smile turns into an ecstatic expression. AV application on the net → AV experience shoot

  • amateur censoredamateursirosiro-4379siro4379siro-4379
    • 2021-01-06
    481 min

    [YVG-024]21 Girls Get Horny For Real While Showing Off Their Panties And Cum Like Crazy! All-POV Underwear Masturbation Challenge!

  • censoredslutYVGglory questYVG-024YVG02413yvg00024
    • 2021-01-15
    45 min

    [srcn-062]ゆうか(24)

  • amateur censoredcreampieamateursrcnsrcn-062srcn062srcn-062
    • 2021-02-11
    301 min

    [MIST-327]Bubble Massage With Cowgirl Sex As A Bonus - 300 Minutes

  • hasumi claire hosaka eri censoredcreampiebig titsMISTmr michiruMIST-327MIST3271mist00327
    • 2021-02-13
    119 min

    [DVAJ-498]I Brought My Colleague To A Hotel And She Spent All Night Sucking My Dick And She Just Wouldn't Quit A Plain Jane Office Lady Kawakami-san Nanami Kawakami

  • kawakami nanami censoredblowjobsingle workDVAJalice japank westDVAJ-498DVAJ498dvaj00498
    • 2021-02-20
    31 min

    FC2PPV 1695074 For a limited time [Individual] A wife who shakes her body and makes a strong face and screams and is forced to vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-06
    100 min

    [ADN-303]Confessions Of A Meaty, Flirty Wife I Have Been Neglected My Husband, And Now I've Been Cumming Over And Over Again With My Excessively Horny Father-In-Law As We Have Filthy, Dirty Sex. Kana Kusakabe

  • kana kusakabe censoredbig titssingle workADNattackerssadao sadaokaotona no dramaADN-303ADN303adn00303
    • 2021-04-13
    62 min

    10musume 041321_01 Solved the sexual problems of amateur girls Sakura Shimozuki

  • amateur uncensored10musume
    • 2021-04-14
    64 min

    FC2PPV 1770132 [Actual condition of sperm donation] Department store receptionist wife 25 years old [Sweet beautiful voice] SNS ＃ Married woman who came by sperm donation vaginal cum shot! Head bug in the first cock uterus kiss Ahegao convulsions Acm

  • amateur uncensoredfc2
    • 2021-05-11
    129 min

    [KTRA-296]Really Crazy Girl Creampied - Akane Shiki

  • shiki akane censoredcreampiebig titsKTRAk tribeKTRA-296KTRA296
    • 2021-05-15
    47 min

    FC2PPV 1818636 Weekend limited [Individual shooting] Prefectural general course ② Black-haired fair-skinned girl with big breasts. Staying Gonzo that was stored for various reasons

  • amateur uncensoredfc2
    • 2021-05-20
    62 min

    10musume 052021_01 Please blame me in a naked apron Yu Tsuruno

  • amateur uncensored10musume
    • 2021-05-21
    119 min

    [CJOD-295]Bored Wives: My Neighbor Julia Moved Out Into The Country For Her Husband's Job And Now She's Got Nothing Better To Do Than Seduce Me Into Giving Her My Creampie With Her No Bra And No Panty Outfit... JULIA

  • julia censoredcreampieslutCJODchijo heavendragon nishikawaCJOD-295CJOD295cjod00295
    • 2021-05-29
    133 min

    [JJCC-002]Cheating Wife Who Wants Sperm

  • censoredcreampiebig titsJJCCjukujo japanJJCC-002JJCC002jjcc00002
    • 2021-06-02
    88 min

    300MAAN-659 [Sweat Duck x Orgy] "Sayaka-san"’s Marunage Request! Soul and soul full sex! Eat steak and keep shaking your hips as long as you keep fit! Massive squirting inevitable lack of water! Enjoy long-time sex in a state of sweat, t

  • amateur censoredcreampiesquirtingmaanmaan-659maan659300maan-659
    • 2021-06-10
    160 min

    [MIST-340]Private Titty Pub - Her Employer's At Risk Of Going Out Of Business, So One Of The Hostesses Agrees To Meet With Just The Two Of You... And Offers You Creampie Sex On The Down-Low Hazuki Wakamiya

  • wakamiya censoredcreampiebig titsMISTmr michirusaitaMIST-340MIST3401mist00340
    • 2021-06-19
    45 min

    H0930 ki210620 Mami Okuda 31years old

  • amateur uncensoredh0930
    • 2021-06-24
    207 min

    [SW-784]"You Can't Fall In Love With Any Other Girls, Only Me! S********l Suddenly Pays A Surprise Visit To My House Where I'm Living Alone! And For Some Reason She's Totally In Love With Me Acting All Clingy And Kissy! Before I Know

  • narita tsumugi censoredsingle workSWswitchraito fuji makotoswitch hibinoSW-784SW7841sw00784
    • 2021-06-26
    57 min

    FC2PPV 1889535 [Personal shooting] Kure is 18 years old with beautiful legs and big tits and vaginal cum shot in a convulsive pussy. [Mountain shooting]

  • amateur uncensoredfc2
    • 2021-07-03
    240 min

    [YMDD-235]Thanks For Everything! Event Queen! An Takase! Complete Retirement! Best!

  • an takase censoredcreampiebig titsYMDDmomotaro video publishingdr ishikiri bridgeyoung peachYMDD-235YMDD235ymdd00235
    • 2021-07-10
    130 min

    [AVSA-172]SUPER FISHEYE FETISHISM Voluptuous Nympho Nurse's Thick Curves Honami Akagi

  • honami akagi censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-172AVSA172avsa00172
    • 2021-08-02
    66 min

    SIRO-4591 [First Shot] [Sensitive Glossy Skin] [Cum Every Minute] Sensitive Body Nursery Teacher Who Switches On Immediately. Every Time I Die, My Body Seems To Be Irritable And Repeats Countless Cums .. AV Application On The Net → AV Experience Shoo

  • amateur censoredamateursirosiro-4591siro4591siro-4591
    • 2021-08-06
    180 min

    [EYAN-172]30 Years Old, In The Height Of her Sex Drive. The Astounding J-cups Are Out Of Control. E-BODY Exclusive Housewife Debut.

  • miki shiraishi censoredbig titssingle workEYANe bodyusapyonhanazakari no tsumatachiEYAN-172EYAN172eyan00172
    • 2021-08-11
    96 min

    [ETQR-269][Daydream POV] Temptation Of, And Sex With, A Slut And Beautiful Girl, Marina Saitou

  • marina saito censoredcreampieuniformETQRerotic timeETQR-269ETQR269etqr00269
    • 2021-08-15
    115 min

    [083PPP-2214]昼下がりの主婦10人！夫の居ぬ間に肉棒で突かれて別人のようなだらしないアへ顔をさらしていた(4)

  • amateur censoredbig titsmarried womanpppppp-2214ppp2214083ppp-2214
    • 2021-08-20
    230 min

    [HNDS-071]Why Not Fuck Us Until Morning! A Crazy Night Of Creampie Sluts!! Squirting, Swallowing, Anal, Female Orgasm, Pee, Anything Goes At This Harlem Fuck Party Full Of Nonstop Cumshots !! Mao Hamasaki Kaho Imai Yuri Fukada Azusa Misaki Mitsuki Mi

  • hamazaki mao natsuho imai censoredcreampieslutHNDSbooknanzaki masakiHNDS-071HNDS071hnds00071
    • 2021-08-28
    57 min

    H4610 tk0041 Aki Osagawa 20years old

  • amateur uncensoredh4610
    • 2021-09-04
    243 min

    [MMB-384]LJO One Summer Experience Of (The Last High S*********l)

  • censoredcreampieschoolgirlMMBmomotarou eizou shuppanishikiribashi hakasemomotaro bestMMB-384MMB384mmb00384
    • 2021-10-16
    127 min

    [BBTU-022]Big Tits ASMR Whispering P*ssies For A Mind-Blowing Dripping Cum Crazy Fuck Ena Koume

  • ena koume censoredcreampiebig titsBBTUdogmatenunore no boinBBTU-022BBTU022bbtu00022
    • 2021-10-20
    55 min

    541AKYB-035 Mitsuha (21) A Female College Student Who Loves Kissing Get In Dating (Mitsuha Higuchi)

  • amateur censoredbig titsamateurakybakyb-035akyb035541akyb-035
    • 2021-10-26
    120 min

    [SAN-023]A Cuckold Wife Who Became Absorbed By The Strong Body And Cock Of Mikawaya - Sakura Tsuji

  • sakura tsuji censoredcreampiedeepthroatSANmazakisakura kabinmother mazaSAN-023SAN023h-796san00023
    • 2021-10-27
    72 min

    326FCT-003 Tipsy Figure Is Too Cute! !! Baby-Faced Slender Female College Student Sasa-Chan (22 Years Old) Is Too Comfortable To Insert A Raw Cock And Tears Cum! !! (Hinano Kamisaka)

  • amateur censoredcreampieamateurfctfct-003fct003326fct-003
    • 2021-11-06
    93 min

    300MAAN-713 [Ultimate Proportions X Extremely Constricted Big Breasts X Ubukko New Project That Blooms Erotic! ] [This Is A Treasure Rot] [A Very Slim Busty Girl With One Experienced Person Who Has A Super Erotic Body Appears] [Youthful Moisturized S

  • amateur censoredcreampiebig titsmaanmaan-713maan713300maan-713
    • 2021-11-25
    49 min

    H0930 ki211125 Takako Kuronuma 38years old

  • amateur uncensoredh0930
    • 2021-11-27
    59 min

    519MAZOF-026 [Libido In The Second Growth Period! ] Public JK [Impact Video] Examination Student, Dohamari In Sex With Smadra, Ascending To White Eyes With Convulsive Acme That Does Not Stop Real Masochist Female Cum Shot Sexual Intercourse [Outflow]

  • amateur censoredcreampieuniformmazofmazof-026mazof026519mazof-026
    • 2021-11-30
    59 min

    [HEYZO-2665]Yume Yokoyama Tiny Tits Girl Gets Fucked

  • yume yokoyama uncensoredcreampieheyzo
    • 2021-12-19
    33 min

    FC2PPV 2529130 Until Today! "# 19" A Flower Shop With Big Breasts. The Disordered Appearance Of A Pretty Girl Is Too Eclectic. ♡ Only Raw Wins ♡

  • amateur uncensoredfc2
    • 2021-12-24
    101 min

    [YSN-565]Mitsuki Nagisa"s Ejaculation Management

  • scooping censoredcreampieslutYSNnonYSN-565YSN565h-127ysn00565



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored