jav big tits creampie javcensored censored




FC2MARAWAAASHKDCESDSANMEYDNACRVEMAHDKANATRSDABGMEMKSBJMIAAVENUROYDKBIAVSAHNDADN

2024-02-20
118 min

SPZ-1137 Mature Woman Affair - Vivid Hotel Voyeurism

  • censoredcreampiebig titsSPZnextstar paradiseSPZ-1137SPZ1137h-1664spz01137
    • 2024-02-20
    155 min

    107SDNM-442 Now That Raising Children Has Settled Down, I Have Come To Find My Happiness.Mariko Koto 43 Years Old Final Chapter Dekachin Immediate Saddle, Continuous Vagina Out, Raw Saddle Large Creampie Ring

  • marikokoto censoredcreampiebig titssdnmsdnm-442sdnm442107sdnm-442
    • 2024-02-20
    116 min

    300MIUM-1055 [Natural I Cup Boobs That Leave The Afterimage] Big Breasts That Brushed The Slow Blooming Sex!Acclaimed ● Popping Swamps Www

  • nachan censoredcreampiebig titsmiummium-1055mium1055300mium-1055
    • 2024-02-20
    124 min

    NACR-764 My Sex Friend Loves Dick Torture And Whole Body Licking Caress! ! Kasumi Yuai

  • hanasumi yui censoredcreampiebig titsNACRplanet plushimrockshichidomeNACR-764NACR764h-237nacr00764
    • 2024-02-20
    135 min

    107START-006 A Geek -friendly Gal -friendly Gal Kamiki Liked It For Some Reason ... A Virgin Who Has Been Tossed By A Small Magic Blame With A Smiling Face From The Day Of Forcibly Brushed Down, And Has Been Holding Both Cho And Kokoro.Reijinki

  • shenmueli censoredcreampiebig titsstartstart-006start006107start-006
    • 2024-02-20
    152 min

    SPLY-013 An I-cup Busty AV Actress Seduces A Stiff Office Worker Without A Bra At A Pub! I Took Her Home And Took In The Thick Semen All Over My Body... I"m Dreaming

  • dream censoredcreampiebig titsSPLYsod createkyouseiarabiki musumeSPLY-013SPLY0131sply00013
    • 2024-02-20
    103 min

    263HDKA-295 Hakaka"s Housekeeper Naked Housekeeper Introduction Office Gokkaichi Mei

  • meiitsukaichi censoredcreampiebig titshdkahdka-295hdka295263hdka-295
    • 2024-02-20
    122 min

    NACR-767 Tsuresari Aphrodisiac Pregnant Black-haired Beauty Satomi Suzuki

  • satomi suzuki censoredcreampiebig titsNACRplanet plusrecobashichidomeNACR-767NACR767h-237nacr00767
    • 2024-02-20
    122 min

    263NACR-768 Oil Mania Sakura Mayu

  • sakuramahi censoredcreampiebig titsnacrnacr-768nacr768263nacr-768
    • 2024-02-19
    61 min

    NHDTB-89202 [Sakura, 19 Years Old] The Weak Point Of The Unfriendly Dating Girl Who Refuses To Be Raw Is The Clitoris. When She Cums By Rubbing The Tip, She Removes The Rubber Band Without Permission And Inserts It Raw! Creampie Piston As It Is! !

  • censoredcreampiebig titsNHDTBnatural highraftin maeshironatufileNHDTB-89202NHDTB892021nhdtb89202
    • 2024-02-19
    69 min

    NHDTB-89201 [Noa 20 Years Old] The Weak Point Of The Unfriendly Dating Girl Who Refuses To Be Raw Is The Clitoris. When She Cums By Rubbing The Tip, He Removes The Rubber Band Without Permission And Inserts It Raw! Creampie Piston As It Is! !

  • censoredcreampiebig titsNHDTBnatural highraftin maeshironatufileNHDTB-89201NHDTB892011nhdtb89201
    • 2024-02-19
    71 min

    534CRT-056 Wearing 10 Hours [Personal Shooting] J -cup White Pants And P Live _ It Is Seeded To A Beautiful Small Woman Who Is Too Huge.

  • amateur censoredcreampiebig titscrtcrt-056crt056534crt-056
    • 2024-02-19
    60 min

    534IND-128 Face [Personal Shoot] With A Brown H Cup Young Lady, P -live _ Until The Seeds Are Released

  • amateur censoredcreampiebig titsindind-128ind128534ind-128
    • 2024-02-18
    112 min

    300MIUM-1061 [Scandalous Huge Breasts] Rent A Tall F Cup Beauty Club Member As Your Girlfriend! A Complete Record Of The Entire Story Of How He Seduced Her And Even Performed Erotic Acts That Were Originally Prohibited! ! A BODY Unlike Any Japanese W

  • amateur censoredcreampiebig titsmiummium-1061mium1061300mium-1061
    • 2024-02-18
    58 min

    490FAN-205 Plump Chubby A5 Rank Delivery Health Girl

  • amateur censoredcreampiebig titsfanfan-205fan205490fan-205
    • 2024-02-18
    76 min

    BEAF-107 The Stimulation Is Too Strong And The Aphrodisiac Is 100 Times More Sensitive, Making The Whole Body"s Erogenous Zones Obedient And The Meat Becomes A Masturbator.Big Tits, Plain Delusion, Rotten Female Otaku, BL Lover, Delusional Hentai

  • censoredcreampiebig titsBEAFaisumanBEAF-107BEAF107h-1615beaf00107
    • 2024-02-17
    104 min

    MAAN-954 [Miracle Body Line] I Want To Play Without Telling My Boyfriend! This Time, The Beautiful Woman Behind The Scenes Is [a Slutty Nurse In A White Coat] Who Came Into Contact With Her During A Break → Went To The Hotel By Car! Under The White C

  • amateur censoredcreampiebig titsmaanmaan-954maan954maan-954
    • 2024-02-17
    150 min

    GVH-624 A Big-breasted Obedient Gravure Idol Who Will Let You Fuck When You Want To Fuck, Is An Obscene Erotic Cosplay And Can Creampie All You Want Kaoru Yasui

  • yasui kaoru censoredcreampiebig titsGVHglory questukichiGVH-624GVH624gvh00624
    • 2024-02-17
    130 min

    ONSG-075 Big Tits Delivery Health H Cup Noa Hazuki

  • hazuki notaka censoredcreampiebig titsONSGgain corporationONSG-075ONSG075onsg00075
    • 2024-02-17
    88 min

    230OREMO-138 Big Sister S138

  • amateur censoredcreampiebig titsoremooremo-138oremo138230oremo-138
    • 2024-02-17
    58 min

    CRNX-101 [4K] I Was Made To Cum So Much That I Wanted To Cry By My Master Who Only Felt Disgust... Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsCRNXcrystal picturecrystal nextCRNX-101CRNX101crnx00101
    • 2024-02-17
    125 min

    MRPA-003 A Busty Wife Who Fell Prey To An Unscrupulous Business Trip Beauty Salon.Aoi Amano Gets Addicted To The Pleasure Of Having Her Big Tits Smeared With A Highly Addictive Aphrodisiac And Begs For Cum All Day Long.

  • ao amano censoredcreampiebig titsMRPAmrs emmanuelnortonmrs breastsMRPA-003MRPA003mrpa00003
    • 2024-02-17
    54 min

    CRNX-098 [4K] My Neighbor Has Big Breasts And Is A Frustrated Divorced Wife Ai Abe

  • abe ai censoredcreampiebig titsCRNXcrystal picturecrystal nextCRNX-098CRNX098crnx00098
    • 2024-02-17
    73 min

    CRNX-099 [4K] Big Tits Seduction While My Brother Is Away, Creampie With My Sister-in-law Hikari Hime

  • hikari hime censoredCRNXcrystal picturecrystal nextCRNX-099CRNX099crnx00099
    • 2024-02-17
    63 min

    586HNHU-0095 Individual Shooting Pick-up #Beautiful Body Gym Instructor #Kansai Beauty #M-shaped Cowgirl Position Best #Horo●i #Cleaning Blowjob

  • amateur censoredcreampiebig titshnhuhnhu-0095hnhu0095586hnhu-0095
    • 2024-02-17
    57 min

    INSTV-540 [Nagoya Beauty] Future Shachihoko Announcer! Mei, 25 Years Old, The Onikawa Castle Girl I Picked Up At Nagoya Castle Is Super Beautiful! Hotel Brought Home Video Creampie SEX

  • censoredcreampiebig titsINSTVhmn worksinstaINSTV-540INSTV540h-1472instv00540
    • 2024-02-17
    41 min

    229SCUTE-1433 Mei (22) S-Cute Nikkan Purun! Big Boobs And Round Ass H

  • amateur censoredcreampiebig titsscutescute-1433scute1433229scute-1433
    • 2024-02-17
    121 min

    BKD-326 Mother And Child Mating ~ Shin Mikuniji ~ Akari Niimura

  • akari shinmura censoredcreampiebig titsBKDrubyshakojijourneyBKD-326BKD326bkd00326
    • 2024-02-17
    121 min

    KSBJ-288 Yukari Ayano, A Part-timer Who Specializes In Sex Processing And Comes Looking For Masochist Training

  • ayano yukari censoredcreampiebig titsKSBJksb planning emanuelrecobaKSBJ-288KSBJ288ksbj00288
    • 2024-02-17
    52 min

    CRNX-100 [4K] Big Butt Personal Trainer"s Beautiful Butt Temptation Erika Ozaki

  • ozaki erika censoredcreampieblowjobCRNXcrystal picturecrystal nextCRNX-100CRNX100crnx00100
    • 2024-02-16
    40 min

    393OTIM-341 Video Posted By An Office Lady By Gang Stalkers Renka

  • amateur censoredcreampiebig titsotimotim-341otim341393otim-341
    • 2024-02-16
    200 min

    PRED-558 Karen Yuzuriha Lives With A Beautiful Older Sister, Using An Empty Old Private House As Her Love Nest And Having Sex With Her Very Intensely.

  • karen kaede censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-558PRED558pred00558
    • 2024-02-16
    130 min

    MIDV-625 A Big-breasted H-cup Married Woman Has An Affair With A Male College Student For The Sake Of Her Seedless Husband. A Man And A Woman Who Have 20 Fucks With 3 Part-time Jobs A Week. Fumika Nakayama

  • nakayama fumika censoredcreampiebig titsMIDVmoody strendy yamaguchimoodyz divaMIDV-625MIDV625midv00625
    • 2024-02-16
    140 min

    FPRE-012 I Was Stuck At Work And Got Hurt After Fighting With My Boyfriend... A Rainy Weekend With My Student Who Couldn"t Go Home And Her Instincts Led Us To Each Other"s Wet Bodies And Ejaculated Deep Inside Her Vagina Over And Over Again.

  • reina taoyua censoredcreampiebig titsFPREfitchtrendy yamaguchipreciousFPRE-012FPRE012fpre00012
    • 2024-02-16
    39 min

    393OTIM-342 Job Hunting FILE Sana (pseudonym)

  • amateur censoredcreampiebig titsotimotim-342otim342393otim-342
    • 2024-02-16
    240 min

    MIDV-627 If You Resist Ejaculation Once An Hour With Ibukin"s Smiling God Service Technique, You Will Be Creampied Raw! A Heart-pounding Overnight Hot Spring Trip Where You Can Go Home Immediately If Something Goes Wrong In Amateur Fan Thanksgivi

  • aoi ibuki censoredcreampiebig titsMIDVmoody szampamoodyz divaMIDV-627MIDV627midv00627
    • 2024-02-16
    137 min

    702NOSKN-076 20 Year Old H Cup Pink Areola! 1 Night Of Raw Sex And Creampie With The Overwhelmingly Big Breasted Peach Butt Beautiful Girl Suzu Aiho @ Northkins! [Creampie Document]

  • aihosuzu censoredcreampiebig titsnosknnoskn-076noskn076702noskn-076
    • 2024-02-16
    119 min

    MEYD-881 At My Son"s School Festival, The PTA President, Mr. Sayama, Gave Him An Extremely Naughty Sex Education! ! Sayama Love

  • sayama love censoredcreampiebig titsMEYDtameike gorotiger gavelMEYD-881MEYD881meyd00881
    • 2024-02-16
    241 min

    MBM-790 Real Crime Scene Of A Mature Woman Helper 12 Erotic And Gentle Helpers 4 Hours 3

  • censoredcreampiebig titsMBMmbmsasazuka garouMBM-790MBM790h-460mbm00790
    • 2024-02-16
    165 min

    DVMM-069 General Male And Female Monitoring AV Big Breasted Female College Student! Could You Please Wash Your Dick In The Men"s Bath With Just A Towel？ 3 Surrounded By The Fully Erect Penises Of Male Customers, I Feel Embarrassed As I Squeeze, S

  • censoredcreampiebig titsDVMMdeepskomatsu seventeendeep sDVMM-069DVMM069dvmm00069
    • 2024-02-16
    150 min

    EBWH-064 Surrounded By Big-breasted Adventurers With Their Own Reasons And Problems, Enjoy Sex! ？ The Result Of Me, A Healer, Joining An All-female Party.The First Live-action Version Of The Parallel World Harem Manga! !

  • kashiwagi konatsu yuna mitake censoredcreampiebig titsEBWHe bodydazai chinpoEBWH-064EBWH064ebwh00064
    • 2024-02-16
    67 min

    ddh-245 Noa(24)

  • amateur censoredcreampiebig titsddhddh-245ddh245ddh-245
    • 2024-02-16
    120 min

    KAM-175 A Leaked Video Taken By The Owner Of A Long-established Inn In The Kanto Area. Sleeping Pills Aimed At A Beautiful Wife On A Women"s Group Comfort Trip. Creampie Rape Video 3. A Drink Was Placed In The Room Of The Inn Where She Was Stayin

  • naoko yokoyama censoredcreampiebig titsKAMkarmagroupKAM-175KAM175kam00175
    • 2024-02-16
    95 min

    VEC-632 Bringing A Beautiful Married Woman Who Works Part-time Into The House And Having Creampie Sex Mei Itsukaichi

  • itsukaichi mei censoredcreampiebig titsVECvenuskanyegoddess venusVEC-632VEC632vec00632
    • 2024-02-16
    225 min

    DVMM-064 MM Special Edition: Big-breasted AV Actress Picks Up Amateur Men! Invitation To A Full Course Service And Reverse 4P Harem Creampie Heaven At The Blue Sky Triple Big Breasts Beauty Salon! In The Magic Mirror Yuria Yoshine, Waka Misono, Miu A

  • yoshine yuria misono waka censoredcreampiebig titsDVMMdeepsueda mushroomthe magic mirror mm mm flightsDVMM-064DVMM064dvmm00064
    • 2024-02-16
    120 min

    PPPE-193 A Reversal Of Positions And A Compliant Pet. I Made My Cheeky Big-boobed Older Sister Who Makes Fun Of Me Understand By Humiliating Her With An Obscene Costume! Aiho Suzu

  • aiho ti censoredcreampiebig titsPPPEoppaiPPPE-193PPPE193pppe00193
    • 2024-02-16
    127 min

    MXGS-1323 Marshmallow H Cup Busty Beauty Gets Addicted To The Sensual Slippery Climax Oil Massage Anna Hanayagi

  • hanayanagi anna censoredcreampiebig titsMXGSmaxingMXGS-1323MXGS1323h-068mxgs01323
    • 2024-02-16
    160 min

    MIDV-629 Lifting Of The Ban: Creampie Sex For The First Time In My Life Sara Isshiki

  • isshiki sara censoredcreampiebig titsMIDVmoody smamezawa mametaromoodyz divaMIDV-629MIDV629midv00629
    • 2024-02-16
    120 min

    PPPE-195 The Straight-laced Old Man Can"t Resist Seeing His Big-breasted Niece"s Free-spirited, Defenseless, Bra-less Nipples Flashing And Fluttery Side Breasts, Which He Took In For Discipline, So He Sucks Her Breasts And Rubs Them Violently

  • kasumi tsukino censoredcreampiebig titsPPPEoppaiPPPE-195PPPE195pppe00195
    • 2024-02-16
    140 min

    MUKC-052 Estrus Cosplayer Immersed In Old Man Sensitive Mass Incontinence, Peeing, Squirting Off-paco 5SEX Miku Arima

  • arima misaki censoredcreampiebig titsMUKCinnocentsolid costMUKC-052MUKC052mukc00052
    • 2024-02-16
    120 min

    MVSD-584 Ten Days Later, My Only Beloved Sister Was Broken To The Point Of Collapse. Mizuki Yayoi, A Hidden Lewd Sister Who Was Meant To Be My Substitute But Loved Sex So Much That She Instantly Fell For The Extremely Thick Dick Of An Unparalleled Ga

  • mizuki yayoi censoredcreampiebig titsMVSDm s video groupMVSD-584MVSD584mvsd00584
    • 2024-02-16
    150 min

    EBWH-072 My Brother"s Wife"s Physical Beauty Is Too Attractive... Aphrodisiac Is Mixed With Protein And A Strong Woman"s Body Is Confirmed To Be Pregnant, Creampie Sex Maria Chihaya

  • chihaya maria censoredcreampiebig titsEBWHe bodytrendy yamaguchiEBWH-072EBWH072ebwh00072
    • 2024-02-16
    140 min

    MVSD-583 A Double Bourgeois Married Woman"s Splendid Dick Play A Man-eater Mature Woman Who Sucks Up The Young Man"s Dick Extract And A Lewd Slut Sex Covered In Pheromones Yuri Oshikawa Mary Tachibana

  • yuri sugawa tachibana mary censoredcreampiebig titsMVSDm s video groupthere is alsoMVSD-583MVSD583mvsd00583
    • 2024-02-16
    40 min

    393OTIM-337 Video Posted By Office Lady Wakaba By Gang Stalker

  • amateur censoredcreampiebig titsotimotim-337otim337393otim-337
    • 2024-02-16
    120 min

    PRED-561 When Asked, She Gets Wet To The Core...The Days When A Big-breasted Wife Indulges In Unfaithful Creampies With A Younger Man. JULIA

  • julia censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-561PRED561pred00561
    • 2024-02-16
    240 min

    MKCK-352 Creampie Intercourse 84 Times, With A Young Face And Big Breasts, Injecting A Lot Of Thick Sperm Into The Immature Body Of A Girl In Uniform

  • amatsuki azu yuria hafu censoredcreampiebig titsMKCKe bodyMKCK-352MKCK352mkck00352



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored