jav big tits def various worker censored




FC2AUKGVENUCESDNACRPPPDVEMAMEYDATIDNATRFSDSSCJODIPXSTARSCHRVSSNILULUWAAANACXBBANWANZ

2020-12-01
61 min

HEYZO 2406 After 6 -I Can’t Hold Back Sexual Urge- – Yui Minami

  • yui minami uncensoredcreampieheyzo
    • 2020-12-01
    120 min

    [NACR-375]Father-In-Law Falls For His Son's Wife Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiebig titsNACRplanet pluscherryshichidomeNACR-375NACR375h-237nacr00375
    • 2020-12-03
    279 min

    [MADM-135]Picking Up MILFs In Fashionable Masks For Raw Fucks - If They Dress Well They Must Be Horny, Right？!

  • kazumi ikeya yuki nanami censoredcreampiebig titsMADMcrystal picturetakeshi matsudairamadam maniacMADM-135MADM13549madm00135
    • 2020-12-04
    53 min

    374SHOW-037 Mao

  • amateur censoredamateurbeautiful girlshowshow-037show037374show-037
    • 2020-12-07
    41 min

    [ore-729]レナ 2

  • amateur censoredcreampieamateuroreore-729ore729ore-729
    • 2020-12-18
    82 min

    259LUXU-1352 Luxury TV 1341 H-cup dental hygienist with 1 experienced person debuts! !! A glamorous sensitive body that makes you feel too much after having sex for the first time in a long time. Instinct full-throttle obscene sexual intercourse that

  • amateur censoredbig titsamateurluxuluxu-1352luxu1352259luxu-1352
    • 2020-12-18
    44 min

    FC2PPV 1611540 [Personal shooting / Creampie] Only this big tits is handled … A busty wife who is vaginal cum shot while hiding her husband’s whereabouts

  • amateur uncensoredfc2
    • 2021-01-02
    78 min

    [IMPNO-028]Innocent Anguish Mont Blanc/Ran

  • censoredanalIMPNOimpactnon label impactIMPNO-028IMPNO028h-1154impno00028
    • 2021-01-15
    195 min

    [SABA-670]All New A Job Hunting College Girl Creampie Raw Footage Of Job Interviews vol. 005

  • censoredcreampieamateurSABAskyu shirototodoSABA-670SABA670h-244saba00670
    • 2021-01-25
    118 min

    SMUK-035 Mao

  • amateur censoredcreampieschoolgirlsmuksmuk-035smuk035smuk-035
    • 2021-02-07
    149 min

    [DNJR-044]A Nympho Home Tutor Who Licks Men's Shameful Parts - Miori Saito

  • miori saito censoredblowjobslutDNJRdog daydreamersmaboroshikoDNJR-044DNJR044dnjr00044
    • 2021-02-13
    45 min

    C0930 hitozuma1348 Itsumi Takekura 27years old

  • amateur uncensoredc0930
    • 2021-02-19
    235 min

    [SIM-110]I'm Here To Offer My Little Stepsister For Sale She Was Filmed While Having NTR Creampie Sex With Her Big Stepsister's Boyfriend, And Now We're Selling The Footage Without Permission. Things Got Out Of Control And They Even Did S

  • censoredcreampiebig titsSIMprestigeshirotomanmanSIM-110SIM110118sim00110
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-28
    123 min

    [MDUD-454]Wataru Ishibashi's Amateur Creampies 2

  • censoredcreampieamateurMDUDartwataru ishibashiartmodeMDUD-454MDUD454mdud00454
    • 2021-03-01
    301 min

    [DKSB-105]Reaching The Peak Of Pleasure 100 Times! Non-Stop Dildo Masturbation 3 20 Girls 5 Hours

  • censoredamateurDKSBofficekDKSB-105DKSB10536dksb00105
    • 2021-03-02
    79 min

    [SDDE-641]I Used To Be Cool Live Action Version Bittersweet Sex Between Step Sister And Step Brother Who Stopped Going To School Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsSDDEsodeasy matsumotosenzSDDE-641SDDE6411sdde00641
    • 2021-03-06
    119 min

    [SSIS-008](Abnormal Extreme Climaxes) The Ultimate Erotic Awakening! Waves Of Surging Nonstop Carnal Passion Until She's Totally Satisfied Rena Kodama

  • kodama rena censoredsquirtingbeautiful girlSSISs1 no 1 styleichigoharaSSIS-008SSIS008ssis00008
    • 2021-03-28
    61 min

    230OREX-253 Rika

  • amateur censoredcreampiebig titsorexorex-253orex253230orex-253
    • 2021-04-03
    132 min

    [CMF-059]Aggressive And Sweet Masochistic College Girl Has Her Holes Double Broken In Akane Shiki

  • akane shiki censoredbdsmsingle workCMFcinemagicdirty kudoninhuCMF-059CMF059cmf00059
    • 2021-04-10
    61 min

    383REIW-055 Waka

  • amateur censoredbig titsamateurreiwreiw-055reiw055383reiw-055
    • 2021-04-10
    54 min

    H0930 tk0032 Miria Kifuji 30years old

  • amateur uncensoredh0930
    • 2021-04-15
    130 min

    [JRZE-041]First Time Filming My Affair: Aya Kasuga

  • kasuga aya censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-041JRZE041h-086jrze00041
    • 2021-04-23
    160 min

    [JUFE-283]POV Footage Of Male Subs Getting Fucked! Beautiful Young Dual Succubi Tease Guys Until They Squirt! Wan Horikita Marina Saito

  • horikita wan marina saito censoredsquirtingschoolgirlJUFEfitchsamoariJUFE-283JUFE283jufe00283
    • 2021-04-26
    129 min

    300MIUM-698 Beautiful legs pants suit is erotic Asagaya OL GET! !! The sexual desire accumulated by BL writers who have experience of opening stores explodes tonight! !! The flow of vaginal cum shot → de S awakening is unpredictable and continuous! !

  • amateur censoredcreampiebig titsmiummium-698mium698300mium-698
    • 2021-04-28
    50 min

    [042821-001][VR] A Popular Pub Beauty

  • yui kisaragi uncensoredhandjobbukkakecaribbeancom
    • 2021-05-08
    208 min

    [BAZX-289]The Creampie Idol Sleeps Her Way To The Top vol. 015

  • censoredcreampieuniformBAZXbazookatodoBAZX-289BAZX289bazx00289
    • 2021-05-15
    124 min

    [KAGP-183]An Ordinary Amateur Girl Enjoys Dildo Masturbation 7

  • censoredamateurKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-183KAGP183kagp00183
    • 2021-05-17
    37 min

    498DDH-015 [Deliher Voyeur] A super delicate younger sister with a waist of 54 cm, a beautiful small breasts deli lady wears erotic costumes on a tiny body and serves the production!

  • amateur censoredcreampieamateurddhddh-015ddh015498ddh-015
    • 2021-05-20
    88 min

    [DMAT-193]I Witnessed My Little Stepsister In The Throes Of Masturbation ...

  • censoredsisterdeepthroatDMATstar paradisedamatenDMAT-193DMAT193h-254dmat00193
    • 2021-06-04
    90 min

    277DCV-183 Is it okay to send it home？ case.177 8 Life! A model figure that seems to have jumped out of a magazine! Moreover, big breasts! This is a super body! ⇒ Does a good-shaped dick get angry with a woman？ A rare cock mania that rolls up spear!

  • amateur censoredbig titssquirtingdcvdcv-183dcv183277dcv-183
    • 2021-06-05
    117 min

    [LOL-195]Mouth Specialist... "Stepbrother, Forgive Me..." Marina Keeps Getting Fucked By Her Stepbrother! With Marina Saito

  • marina saito censoredcreampiebeautiful girlLOLglay zloli senkaLOL-195LOL19512lol00195
    • 2021-06-11
    82 min

    300MIUM-715 Apparel Clerk Spree Spree 8 Times A Week! !! Ma ● Ko is tight, but the guard is Yuruyuru! !! !! [Pleasure enthusiast who loves sex with tight ass & beautiful breasts! !! ] × [Transcendental sensitive minimalist who squirts immediately

  • amateur censoredamateurmiummium-715mium715300mium-715
    • 2021-06-26
    244 min

    [MCSR-441]Forbidden Sexual Nursing Caregivers Who Enjoy Taking Care Of What's Below The Belt 10 Girls 4 Hours

  • sumika nagao sakura censoredgrandfatherMCSRbig morkalsaburo kamegashimamascottMCSR-441MCSR44157mcsr00441
    • 2021-07-01
    58 min

    FCP-026 [Delivery Only] Muchipuri Best Ass Job! !! ＃ 1 I’ll make you feel good with my big ass …! !!

  • amateur censoredamateurbeautiful girlfcpfcp-026fcp026fcp-026
    • 2021-07-02
    184 min

    [NKKD-213]Taking A Married Woman Into The Public Bathrooms While She's On A Drive With Her Family And Fucking Her! 7 Toilet Sex

  • censoredNKKDjet eizomanji groupNKKD-213NKKD213nkkd00213
    • 2021-07-16
    35 min

    FC2PPV 1924199 First Shot! !! Limited Price Up To 500 Pieces! [Uncensored] Elegant, Neat And Noble Beauty … At The End, She Begs Her To Abandon Her Pride And Strangle Her, And Then Vaginal Cum Shot! Twice! !! (Blow Scene Appearance)

  • amateur uncensoredfc2
    • 2021-07-23
    56 min

    FC2PPV 1936648 [Individual Shooting 47] Two People’S Appearance 20-Year-Old Streak Pie Bread And 3p Finally Cleaning Fellatio Firmly From Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-07-27
    71 min

    300NTK-612 [Namaiki Kansai Beauty Gal Kimo Uncle Ji ○ Seeded Pleasure Fell! !! ] Fucking Cheeky P Activity Expedition Gal Negotiations & Netinechi Uncle Tech And Pleasure Fell From Disgust In The Direction Of Pleasure! !! The Temptation To Insert

  • amateur censoredcreampieamateurntkntk-612ntk612300ntk-612
    • 2021-08-31
    60 min

    SIRO-4614 [First Shot] [Dignified Black-Haired Beauty] [Rampaging Beautiful Breasts] An Apparel Salesperson Whose Crying Mole Brings Out Sexyness. A Beautiful Black-Haired Woman With M Temperament Shakes The Beautiful Breasts Of The F Cup In All Dire

  • amateur censoredbig titsamateursirosiro-4614siro4614siro-4614
    • 2021-09-09
    104 min

    [GS-402]Step-cousin Comes To The City To Start College, Her Body Is More Mature Now And She"s Staying From The Afternoon Until Late For A Night Visit!! After A Long Tour Around The City, She Comes Back To My Room In Her Underwear For A Midday Nap

  • censoredschoolgirlGSsosoru x garconred ballGS-402GS402h-101gs00402
    • 2021-09-09
    60 min

    515BTGL-018 Rin (24)

  • amateur censoredcreampieamateurbtglbtgl-018btgl018515btgl-018
    • 2021-09-17
    124 min

    [TPPN-205]Rurucha"s TEPPAN Premier! A Cum Soaked Daze With Plenty Of Squirting And Love Juice! Nonstop Group BUKKAKE

  • rurucha censoredsquirtingsingle workTPPNteppanTPPN-205TPPN205tppn00205
    • 2021-09-30
    55 min

    FCP-045 [Delivery Only] New "Wait, Eh! In A Place Like This !？" If You Get Caught, A Beautiful Girl Pulls Out Ji ● Po In A Bad Place! 2 (Yuzuki Liana Higuchi Mitsuha Yuki’s)

  • amateur censoredamateurslutfcpfcp-045fcp045fcp-045
    • 2021-09-30
    64 min

    200GANA-2567 Sex Hidden Camera Brought In In The Spear Room Of A Nampa Master Of Hyakusen Hakusen 219 I Feel That The Boobs Of Saffle Who Reunited After A Long Time Are Getting Bigger … "Is It Good To Massage After A Long Time？" Flush Wh

  • amateur censoredbig titsamateurganagana-2567gana2567200gana-2567
    • 2021-10-01
    146 min

    [CAWD-285]I Came To Fuck Your Little NIPPPPLLLES. - Nipples Orgasm - Mayuki Ito

  • maiyuki ito censoredbig titsslutCAWDkawaiisamoariCAWD-285CAWD285cawd00285
    • 2021-10-13
    89 min

    [ZOZO-085]Shame! Health Check Before The Arrival Of A Newly-graduated Nurse - Mai Kamisaki Edition -

  • censoreduniformnurseZOZOsadie willenauZOZO-085ZOZO0851zozo00085
    • 2021-10-23
    164 min

    [GENM-092]An Illusionary Going Out for a Drive, Yuki Yoshizawa

  • yuki yoshizawa censoredbig titsbeautiful girlGENMgenekig3GENM-092GENM092genm00092
    • 2021-10-29
    77 min

    529STCV-030 A Beautiful Mom In Ginza Who Is Chaste Is Suddenly Changed! ？？ A Human Sprinkler Who Sucks On Ji ● Po For The First Time In Several Years And Repeats The Climax Of Beautiful Legs Gakuburu Convulsions And Scatters The Tide! Unfaithful Sex

  • amateur censoredcreampiemarried womanstcvstcv-030stcv030529stcv-030
    • 2021-11-04
    175 min

    [ABW-163]からかい上手の唯月さん。 いつも僕を弄ぶ唯月さんと青春イチャラブ3本番！！ 唯月優花

  • amateur censoredbig titssquirtingabwabw-163abw163abw-163
    • 2021-11-11
    129 min

    [HAWA-264]This Amateur Wife Was Sent To The Home Of A Normal College S*****t, And Given A Single Condom, And Told To Spend The Night At His Place But Unable To Satisfy Him With One Rubber-Covered Fuck, She Let Him Have 2 Serious Creampie Fucks As Her

  • censoredbig titsHAWAkosumosu eizoumountain moricosmospictures soft on demandHAWA-264HAWA2641hawa00264
    • 2021-11-18
    105 min

    [AKDL-151]My Sister-in-Law With A Big Ass Is Actually My Longtime Friend - I Gave Her A Creampie While My Brother Was Away - Rion Izumi

  • rion izumi censoredcreampieAKDLaquinoriaquinoriaknrAKDL-151AKDL1511akdl00151
    • 2021-12-02
    61 min

    1Pondo 120221_001 Getting Laid With A Calculating But Cute Girl Mone Namikata

  • amateur uncensored1pondo
    • 2021-12-04
    60 min

    H4610 ki211205 Aoi Katayama 26years old

  • amateur uncensoredh4610
    • 2021-12-12
    107 min

    390JNT-031 [Saddle Tide Queen] Matching With A Beautiful And Super-Style Judicial Scrivener! !! We Devour The Best Body That Has The Best Beautiful Breasts And Peach Butt That Is Comfortable To Massage In The Thinly Cracked Abdominal Muscle Body! !!

  • amateur censoredcreampiesquirtingjntjnt-031jnt031390jnt-031
    • 2021-12-17
    39 min

    FC2PPV 2523603 [Personal Shooting, Orgy, Vaginal Cum Shot] A Married Woman Who Accepts And Submits Everything In Front Of Another Stick, Even The Feeling Of Humiliation Turns Into Pleasure …

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored