jav blowjo high visio uniform censored




FC2CHRVLULUAUKGJULSSISATIDHMNDASDABWHZGDSQTEWAAAMIDVMEYDGVHAVSAADNNACRIPXSPRD

2020-10-24
118 min

[CJOD-264]A Sweaty And Horny Slut! This Escaped Convict Hit Me With Compulsory Creampie Sex... 7 Sumire Mizukawa

  • mizukawa violet censoredcreampieblowjobCJODchijo heavenkitorune kawaguchiCJOD-264CJOD264cjod00264
    • 2020-10-24
    168 min

    [HND-896]Raw Creampie 1000 Days After Deciding To Be A Porn Actress Hana Shirato

  • white peach censoredcreampieblowjobHNDhon nakamametaro mamezawaHND-896HND896hnd00896
    • 2020-11-06
    227 min

    [DOCP-256]This Hostess Princess Had Such Soft Big Tits That Were Practically Spilling Out Of Her Shirt That They Were Positively Stimulating, And When She Noticed Me Staring At Them, She Smiled Sweetly, With Hungry Lust In Her Eyes... 2

  • censoredbig titsDOCPprestigedoc premiumDOCP-256DOCP256118docp00256
    • 2020-11-12
    124 min

    [FSDSS-122]Immediate Challenge During A Gravure Shot With No Adult Actions Allowed - Moe Tenshi

  • angel moe censoredblowjobbeautiful girlFSDSSfalenotake dfaleno starFSDSS-122FSDSS1221fsdss00122
    • 2020-11-21
    74 min

    FC2PPV 1578011 It will not end until 10 shots are pulled out !! Target spear con drinking party H cup gal Akari erotic gal Yukopi

  • amateur uncensoredfc2
    • 2020-12-05
    481 min

    [HHGT-006]Primetime - Select Hot Spring Hotties Special - Deluxe 15 Variety Show 22 Stars! 8 Hours

  • ayane harukana rina minami censoredHHGTgolden timehhh groupHHGT-006HHGT006hhgt00006
    • 2020-12-24
    60 min

    1Pondo 122420_001 Cutie bunny Mikuro Komori

  • amateur uncensored1pondo
    • 2020-12-31
    149 min

    [HUNBL-027]A Domestic Orgy - We Were Dominated By Our Stepfather -

  • censoredcreampieHUNBLhunteraldebaranhhh groupHUNBL-027HUNBL027hunbl00027
    • 2021-01-01
    120 min

    [AWD-121]My Stepmom's Perfect Ass - My Stepmom's Got A Beautiful, Super Sensitive Booty Miya Tanaka

  • miya tanaka censoredbig titsmarried womanAWDrubysusumu yanoguchinext doorAWD-121AWD121awd00121
    • 2021-01-01
    74 min

    FC2PPV 1623423 [No x hair wash] “Fully open” Taking a break while looking at your smartphone! [Part 2]

  • amateur uncensoredfc2
    • 2021-01-15
    45 min

    [srcn-062]ゆうか(24)

  • amateur censoredcreampieamateursrcnsrcn-062srcn062srcn-062
    • 2021-01-25
    100 min

    [SLRO-005]A 34 Year Old Mature Manners Teacher Is A Late Bloomer And Stars In Non-nude Erotica!/Hanae Tsubaki

  • amateur censoredbig titsbeautiful girlSLROintec incSLRO-005SLRO005
    • 2021-01-31
    248 min

    [GAV-059]MILFs In Their Fifties - Raw Creampies

  • censoredcreampiemature womanGAVgogo adult videosGAV-059GAV059gav00059
    • 2021-02-09
    136 min

    [SDJS-107]SOD Female Employee - Assistant Producer, 2 Years On The Job, Chihiro Ogino (24) In Her AV Debut!!

  • chihiro ogino censoredbig titsamateurSDJSsod createyazawa ready to receivesod female employeeSDJS-107SDJS1071sdjs00107
    • 2021-02-12
    40 min

    417SRYA-010 I was targeted by a slime milk crocodile! !! There is a woman’s predecessor in the open-air bath … The cock begins to react to the naked woman’s body, straddling the awkward me, and the semen tank is empty due to the angry

  • amateur censoredcreampiebig titssryasrya-010srya010417srya-010
    • 2021-02-21
    129 min

    [CAWD-179]"Teacher, Do You Not Like Me？" That Day, I Gave In To My S*****t's Temptation, And Crossed That Forbidden Line ... - I Can Never Tell My Wife About The Forbidden Creampie Sex We Had - Yui Amane

  • amane yui censoredcreampieschoolgirlCAWDkawaiijo asagiriCAWD-179CAWD179cawd00179
    • 2021-02-23
    140 min

    [SDTH-002]She's Cum Swallowing 20 Shots Of Cum, All Outdoor! This Maso Bitch Amateur Pretends To Be Prim And Proper, But She'll D***k Down That Cum With A Smile, And Here She Is, Again. From The *** Shopping District In Setagaya, Tokyo A 2nd-

  • censoredSDTHsodafro takahashieromanSDTH-002SDTH0021sdth00002
    • 2021-03-04
    59 min

    1Pondo 030421_001 My girlfriend who was taken down by my father Chako Kurusu

  • amateur uncensored1pondo
    • 2021-03-10
    33 min

    [SDFK-043]"Couples Only" Magic Mirror Allows You To Steal Away The Girl Of Your Dreams And Fuck Her Raw! Aya-san (23 Years Old) Office Worker

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-043SDFK0431sdfk00043
    • 2021-03-14
    78 min

    FC2PPV 1726357 [Actual record] I taught the strictness of adults to P-active girls who are dull and naive.

  • amateur uncensoredfc2
    • 2021-03-19
    231 min

    [SORA-301]This Crazy Exhibitionist JK Is A Dirty Talk Genius And Loves To Show Off, And She Said, "I'll Let You Fuck Me If We Do It Outdoors," And I'm A Normal Guy, But She Kept Working Me Up Until I Got A Maso Erection, And Then I Ex

  • mai takeda censoredslutsingle workSORAyama to soratelephone poleSORA-301SORA301sora00301
    • 2021-03-25
    242 min

    [NHDTB-511]Sudden Nipple Teasing Makes Them Rock Hard! "Not In A Place Like This, You'll Make Me Cum!" Blushing Red Faces, Sensitive Nipples, Moaning With Pleasure - 30 Girls, Extremely Famous Scenes

  • censoredsquirtingNHDTBnatural highNHDTB-511NHDTB5111nhdtb00511
    • 2021-03-25
    40 min

    H4610 ki210325 Sayuri Takagi 20years old

  • amateur uncensoredh4610
    • 2021-04-02
    119 min

    [JUL-537]On A Two Night Three Day Trip I Was Ordered To Stay In The Hotel And Ended Up Seducing The Hot Receptionist... Aoi Mukai

  • ai mukai censoredmature womansingle workJULmadonnasatsugu koyamaJUL-537JUL537jul00537
    • 2021-04-13
    138 min

    [KIRE-032]Her Slender Body Radiates With Overwhelming Beauty An Intellectual Woman With A Bottomless Well Of Lust. At The Hotel, All We Did Was Fuck. A Real-Life Apparel Designer Kozue Minami 26 Years Old

  • minami kozue censoredsingle workKIREsod createcompany matsuobeauty kirei sodKIRE-032KIRE0321kire00032
    • 2021-04-20
    86 min

    [DMAT-192]While This Stepmom Rests Her Stepson Paid Her A Night Visit

  • censoredcreampielingerieDMATstar paradisedamatenDMAT-192DMAT192h-254dmat00192
    • 2021-04-23
    119 min

    [MIAA-427]My Stepdaughter Told Me That She Was Worried About Being Too Slutty, But It Was All A Ruse To Get Me To Fuck Her - Panty Shot Temptation Leads To Had Pounding From Her Stepdad! Wan Horikita

  • horikita wan censoredcreampieblowjobMIAAmoodyzcaptain eharaeveryone s porn starMIAA-427MIAA427miaa00427
    • 2021-04-24
    244 min

    [HMJM-055]Super Best 4 Hours Mizuki Hayakawa

  • mizuki hayakawa censoredbig titssingle workHMJMhmjmcompany matsuoHMJM-055HMJM055h-172hmjm00055
    • 2021-05-15
    121 min

    [MGMQ-072]Masochistic Men Love The Anal Play Teacher In The Nurse's Office Renon Kanae

  • kanae lennon censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-072MGMQ072mgmq00072
    • 2021-05-18
    53 min

    C0930 ki210518 Shiho Kuroda 21years old

  • amateur uncensoredc0930
    • 2021-05-21
    62 min

    230OREC-764 Himari-san

  • amateur censoredcreampiebig titsorecorec-764orec764230orec-764
    • 2021-06-17
    120 min

    [KAGP-187]Young Amateur Girls Made To Give Blowjobs Whenever And Wherever! 8 13 Girls

  • censoredamateurblowjobKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-187KAGP187kagp00187
    • 2021-07-02
    68 min

    FC2PPV 1899108 066 [Creampie & Facials] Creampie & Infinite Facials Sex with a Big-Chicked Adult 1st Year OL On The Way To Work (Big Breasts x God Style x Bukkake)

  • amateur uncensoredfc2
    • 2021-07-11
    73 min

    200GANA-2524 Seriously Nampa, first shot. 1661 Pick up Yangka GAL and bring it to the hotel! Good first-class product! When you take off your overexposed clothes, you will find a delicate body and a cute little girl … Continuous climax with sens

  • amateur censoredamateurganagana-2524gana2524200gana-2524
    • 2021-07-17
    78 min

    Pacopacomama 072121_111 Lady's Good Old Days – Wakana Amane

  • amateur uncensoredpacopacomama
    • 2021-07-24
    240 min

    [ITSR-094](#This Is How You Seduce An Underwear Sales Girl!!) Masters Of Seduction 4 Hours 12 Ladies These Lovely Ladies Are Handing Over Their Freshly Undressed Underwear And Getting Fucked In The Raw, For Your Viewing Pleasure.

  • censoredamateurITSRbig mocalmaxtop itadakiITSR-094ITSR09457itsr00094
    • 2021-08-13
    50 min

    520SSK-019 [No Bra Remote Control Vibe Date Shame Play] [Saddle Shot With Lustful Girlfriend And Love Hotel] [Big Breasts De M Beautiful Girl] [Master-Slave Relationship Planting ♪] [Pregnancy Confirmed By Continuous Vaginal Cum Shot ♪] "Anri-Cha

  • amateur censoredcreampieamateursskssk-019ssk019520ssk-019
    • 2021-08-25
    65 min

    Caribbeancom 082521-001 The Undisclosed: Various Types! Blow Job Of Your Choice Hasumi Yoshioka, Mitsuki Harutori, Kotomi Yamazaki

  • amateur uncensoredhandjobbukkakecaribbeancom
    • 2021-09-10
    124 min

    [IPX-719]Her Boss Makes Her So Sick She Would Rather Die Than Fuck Him, But He Used His Huge Dick To Make Her Cum So Much That She Was Ashamed To Admit That She Enjoyed It Her Perverted Boss Imprinted His Semen Onto Her Iyona Fujii

  • iyo fujii censoredblowjobsingle workIPXidea pocketdragon nishikawadishIPX-719IPX719ipx00719
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-10-02
    130 min

    [AVSA-180]The Hostesses Of This Snack Bar Are A Pair Of Slutty Medusas Who Perform Erotic Tongue Work While Having Hot Sex

  • really chiho nagarekawa censoredbig titsmature womanAVSAavsbuddha davscollectorsAVSA-180AVSA180avsa00180
    • 2021-10-15
    50 min

    FC2PPV 2306905 [Personal Shooting] Reunion Commemorative Vaginal Cum Shot With A Slender Beautiful Wife Kaede With Short Black Hair!

  • amateur uncensoredfc2
    • 2021-10-19
    82 min

    FC2PPV 2357578 A Fair-Skinned 19-Year-Old Female College Student. The Kiss Mark Attached To Her Boyfriend Is Too Erotic And She Unintentionally Shoots An Unintentional Discharge. Massive Vaginal Cum Shot With Her First Cuckold Sex In Her Life Full Of

  • amateur uncensoredfc2
    • 2021-10-25
    15 min

    FC2PPV 2371042 [First And Last Appearance, Limited Sale Of 300] Bg003 12 Shots In Total. A Large Amount Of Bukkake On A Tall 170 Cm SSS Class Beauty Louis Who Loves Semen. She Sticks Out Tongue And Waits For Semen.

  • amateur uncensoredfc2
    • 2021-11-06
    109 min

    [APNS-263]Shameful Home Visit - Hono Konomi

  • yoshimi hono censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-263APNS263apns00263
    • 2021-11-16
    40 min

    481SACZ-095 Chiharu 1

  • amateur censoredamateurbdsmsaczsacz-095sacz095481sacz-095
    • 2021-12-18
    113 min

    [MRHP-002]My Horny Lady Boss With The Big Ass Wants Me To Cum For Her, And She"s Using Every Trick In Her Book To Lure Me To Temptation, But I"m Super Shy, And Never Made A Move, And In The End, She Gets Mad And Milks My Sperm In A Rage Hono

  • honoka wakamiya censoredcreampiesingle workMRHPmisesu no sugao emmanuelleichiro yumisakimarried assMRHP-002MRHP002mrhp00002
    • 2021-12-26
    78 min

    200GANA-2618 Seriously Nampa, First Shot. 1734 Picking Up A Beautiful Secretary Who Loves Both Matching Apps And Vibrators! The Transcendental Fellatio That I Learned By Playing Around Seems To Be Lively Just By Looking At It! ？？ The Sensitivity Is A

  • amateur censoredamateurganagana-2618gana2618200gana-2618
    • 2022-01-15
    241 min

    [OVG-190]Female Body Fetish Encyclopedia 4 - Complete, Fully Naked 66 People

  • censoredbig titsOVGglory questOVG-190OVG190ovg00190
    • 2022-01-18
    55 min

    C0930 ki220118 Masako Fukuda 32years old

  • amateur uncensoredc0930
    • 2022-01-28
    115 min

    [EKW-077]Control by Deep Kiss. Kana Morisawa.

  • kana morisawa kanako iioka censoredblowjobslutEKWwaap entertainmentk westcobra warpEKW-077EKW0772ekw00077
    • 2022-02-11
    149 min

    [MEYD-738]10,000 Social Media Followers! Hookup Over The Internet! You Can Meet Her Immediately If You Book A Reservation! There"s Nothing She Won"t Do And She"s A Cum Swallowing Angel! A Currently Active Yoshiwara Soapland Princess Makes

  • censoredsquirtingblowjobMEYDtameike gorotake dMEYD-738MEYD738meyd00738
    • 2022-03-01
    26 min

    [fc2-ppv 2689932]P活　現役県立2年生　梨沙ちゃん　学校の制服を着せながらの着衣プレイ引き締まった体で締まりも最高で生々しくてエロかった FC2-PPV-2689932

  • amateur uncensoredfc2
    • 2022-03-04
    120 min

    [JUL-894]After The Graduation Ceremony... Here Is A Present From Your Stepmom, Now That You"re An Adult. Yumi Kazama

  • kazama yumi censoredsingle workJULmadonnahimu lockJUL-894JUL894jul00894
    • 2022-03-29
    89 min

    326FCT-008 [Kitsuman Tightening Kyun Kyun! !! ] Gonzo Where A Neat And Clean Shortcut Girl Gets Squid Many Times By Daddy’s Uncle’s Net Re-Blame! !! (Rin Kira)

  • amateur censoredcreampiebig titsfctfct-008fct008326fct-008
    • 2022-04-01
    150 min

    MIDV-082 Is It Okay If You Come Over On Short Notice？ Shocking Call Girl SEX At The Home Of A Masochistic Guy! This Slut Works Hard Till His Balls Explode! Nao Jinguji

  • jinguji temple nao censoredcreampieslutMIDVmoody sgoemonmoodyz divaMIDV-082MIDV082midv00082



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored