jav censored idol celebrity javcensored high visio




FC2KBISDABAWDGVHNACXSANVENUABWMARASTARSSPRDHNDMVSDDTTNACRVEMAMIAASSNIKSBJROYD

2020-10-11
114 min

[APNS-206]For The Guy I Like, I'd Gladly Fall... Drowning In A No-Hoper Sophomore Guy, This Elite Young Lady Is Covered In Semen And Falls Into Working At An Illegal Brothel. Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-206APNS206apns00206
    • 2020-10-11
    121 min

    [APKH-154]Yuki Narumi's Sex Training This Uniformed Pet Girl Has Only Ever Done It Missionary Style, And Now She'll Do It From The Back And In Cowgirl Position!

  • yuki narumi censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-154APKH154apkh00154
    • 2020-10-14
    63 min

    [NYH-042]I Haven't Had A Bath With My Stepdaughter Since She Was Little - Her Grown Up Body Got Me Hard - At-Home Adultery With Noa Noa Kawanishi

  • ai kasai censoredbig titssingle workNYHdirectorsmeow meow houseNYH-042NYH0421nyh00042
    • 2020-10-16
    46 min

    330PER-317 Kanon

  • amateur censoredamateurperper-317per317330per-317
    • 2020-10-22
    140 min

    [MILK-091]Bottoms Up For 9 Hours - Tipsy, Dazed Orgasmic Sex Until Dawn Riona Minami

  • rina minami censoredbeautiful girlsingle workMILKmilkno directorMILK-091MILK091h-1240milk00091
    • 2020-10-30
    149 min

    [ABW-019]Creampies! Ejaculation Executive Officer 07 Has A H-Cup, Shakes Those Huge Titties And Squeezes Impure Sperm! Asuna Kawai

  • asuna kawai censoredcreampiebig titsABWprestigehirahira hendorikkusuabsolutely wonderfulABW-019ABW019118abw00019
    • 2020-10-31
    55 min

    FC2PPV 1553484 [Personal shooting] First shot ★ Seiko The 24-year-old hairdresser is a beautiful woman with long hair! A carnivorous girl who likes intense SEX is violently fucked and vaginal cum shot!

  • amateur uncensoredfc2
    • 2020-11-13
    67 min

    259LUXU-1333 Luxury TV 1326 Its appearance is just a goddess! Nozomi Makita, a hotel front lady who is too beautiful, is back! It seems that frustration has been refined for the first time in the previous work to have sex. A sexually hungry beauty de

  • amateur censoredamateurluxuluxu-1333luxu1333259luxu-1333
    • 2020-11-13
    234 min

    [MUDR-131]"Hey Mister, Let Me Fuck You" This Girl Loves To Give A Blowjob And Loves To Connect Through Deliciously Ravenous Sex

  • censoredblowjobMUDRmukuMUDR-131MUDR131mudr00131
    • 2020-11-13
    241 min

    [SABA-657]Every Babe Has G-Cup Titties Or Bigger! A Female Readers Choice High-Class Oil Massage Parlor Gets The Hidden Camera Treatment! When This Big Tits Beauty Receives An Excessive Sexual Massage, She'll Keep On Cumming Until She Loses Her M

  • censoredbig titsamateurSABAskyu shirotoSABA-657SABA657h-244saba00657
    • 2020-11-16
    17 min

    FC2PPV 1572566 [I will release my masturbation for side dishes without permission] Famous car show ☆ Race queen experience ☆ Lotion Bechobecho White Skating Clothes Man Juice Bicho Bicho Rotor Masturbation ❤ Pussy close-up shooting! !!

  • amateur uncensoredfc2
    • 2020-11-23
    60 min

    FC2PPV 1576023 [Personal shooting] [No] First shot! A girl with a cute smile and a small ass shaved pussy! You can download the main part high-quality ZIP, blowjob and masturbation (48 minutes) as a review privilege

  • amateur uncensoredfc2
    • 2020-11-26
    121 min

    [GS-365]The Girl At My Favorite Bar Is The Stepdaughter Of The Proprietress But She's Way Too Hot Not To Fuck - She Services Me On The Down Low.

  • censoredGSsosoru x garconspada ikebukuroGS-365GS365h-101gs00365
    • 2020-11-28
    149 min

    [MIDE-856]After I Missed The Last Train Home During Our Welcoming Party, My Horny And Newly Graduated Female Colleague Asked Me, "Would You Like To Stay Over At My Place？" With The Sweet Whispering Temptation Of A Little Devil. So I Gave In T

  • jinguji temple nao censoredcreampiebig titsMIDEmoodyzhirokoji osakimoodyz divaMIDE-856MIDE856mide00856
    • 2020-11-29
    71 min

    200GANA-2392 Seriously Nampa, first shot. 1561 A female college student who is worried about the difficulty of remote classes at the university … Actually, are you also worried about ikenai love？ Do you want to radiate your anguished desires, or

  • amateur censoredsquirtingamateurganagana-2392gana2392200gana-2392
    • 2020-12-20
    75 min

    [FUFU-195]Faithful Wife Tricked Into Receiving An Erotic Massage At The Hotel She's Staying At With Her Husband For Their Anniversary Koyuki Kohinata (46)

  • koyuki hyuga censoredamateursingle workFUFUstar paradisefufuFUFU-195FUFU195h-254fufu00195
    • 2020-12-20
    18 min

    FC2PPV 1613859 Limited to 2 days [Individual] Escape from a large amount of debt. A busty wife who is fucked by multiple strangers and drips a large amount of sperm.

  • amateur uncensoredfc2
    • 2020-12-20
    24 min

    FC2PPV 1613458 [Personal shooting] ♀43 Professional student Mi ◯ -chan 18 years old 42nd time Conceived training 1st time, seeding fertilization Gachinko pregnancy confirmation part 2!

  • amateur uncensoredfc2
    • 2020-12-25
    53 min

    [ETQR-183](Daydream POV) Receptionist Who Wants To Get Ravished AOI Aoi Nakajo

  • nakagusuku censoredcreampieuniformETQRerotic timeETQR-183ETQR183h-1186etqr00183
    • 2021-01-10
    125 min

    [SQTE-353]Beautiful Girl Tomboy Likes To Tease But She Also Likes To Cum Mana Hirade

  • hirate mana censoredblowjobbeautiful girlSQTEs cuteSQTE-353SQTE353sqte00353
    • 2021-01-13
    93 min

    FC2PPV 1643292 [Monthly limited 1480pt] “Let’s go for a meal is a signal of H ❤️❤️” I have 3P with a plump beauty with a strong libido ❤️❤️

  • amateur uncensoredfc2
    • 2021-01-26
    65 min

    FC2PPV 1659675 [Individual shooting 30] Prefectural K ③ Active model Shaved ⑮ Kupaa Pour in a beaker after vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-29
    120 min

    [NEM-054]嫁の母と禁断性交 其ノ拾七 妻よりもお義母さんの方がいいよ… 笛木さとみ

  • satomi fueki censoredcreampiemature womanNEMglobal media entertainmentjiro sadogashimanewmomNEM-054NEM054143nem00054
    • 2021-02-01
    118 min

    [GAS-482]Breast Milk, Colossal Tits, Hinami: 1 Liter Of Breast Milk - Hinami Naruse

  • hinami narusawa censoredbig titsmature womanGAScinema unit gasakira takatsukigasGAS-482GAS48271gas00482
    • 2021-02-05
    53 min

    FC2PPV 1673806 [Big breasts sister] Orgy out in a house! Hcup Boyne milk hanging and straddling a man Porcio convulsions big cum ♥ Raw Saddle personal shooting party until morning [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-20
    31 min

    FC2PPV 1695074 For a limited time [Individual] A wife who shakes her body and makes a strong face and screams and is forced to vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-27
    240 min

    [JKSR-484]Housewives With Big Tits So Beautiful They Make You Sigh Hesitantly Accepts A Creampie... SPECIAL - 16 Girls, 4 Hours

  • censoredcreampiebig titsJKSRbig morkalobockeyprink junkyJKSR-484JKSR48457jksr00484
    • 2021-03-05
    121 min

    [SCR-267]Leaked Footage Of Girls Looking For a Sugar Daddy

  • censoredcreampieuniformSCRglay zs crimeSCR-267SCR26712scr00267
    • 2021-03-06
    72 min

    FC2PPV 1715049 Limited to 100 Immediate deletion available ★ First shot premiere ☆ President’s daughter living in Kansai ♥ Menhera beautiful girl Chizuru-chan 22 years old ☆ Over 2000 spear people ♥ Extreme tech blowjob ♥ Raw squirrel cum shot a

  • amateur uncensoredfc2
    • 2021-03-18
    77 min

    FC2PPV 1731348 [No appearance] "Raw is useless …" Unauthorized raw squirrel by a neat and slender beauty. Reason collapsed by being pierced by the uterus with a raw dick.

  • amateur uncensoredfc2
    • 2021-03-22
    51 min

    FC2PPV 1737339 Up to 25 [Individual shooting] Prefectural general course ② Reading mode. I helped while refraining from performing arts activities. Arcade Hotel

  • amateur uncensoredfc2
    • 2021-03-27
    130 min

    [RMER-001]Popsicle Man - Ai Hitomi

  • hitomi love censoredsingle workRMERrare daydream tribetamao arakiRMER-001RMER001rmer00001
    • 2021-04-07
    57 min

    FC2PPV 1758412 ★ First shot amateur ☆ Carnivorous girl ♥ Spanish quarter beauty with pheromones ♥ Young 〇 Chinatsu-chan 23 years old ☆ Exciting! Electric Ma Squirting Iki ♥ Sexuality No Passionate Creampie Sex ♥ [Personal Shooting] * With Benefits

  • amateur uncensoredfc2
    • 2021-04-16
    54 min

    FC2PPV 1773301 [Uncensored] When I met him for the first time in a long time, he turned into a super popular hostess, but Ji ● Po addiction does not heal Former J ● Refre Miss hostess: Mai (19 years old)

  • amateur uncensoredfc2
    • 2021-04-17
    133 min

    [DASD-854]Pretending To Be Seduced And Mercilessly Fucking! Devilish Teacher Ravishes The Moody S*****t President Nanase Asahina

  • asahina nanase censoredcreampieuniformDASDdaschinpo dazaiDASD-854DASD854dasd00854
    • 2021-04-19
    50 min

    328HMDN-355 Active Model Wife 26 Years Old Is Cuckold With A Big Cock And Seeded! Catch with the latest swimsuit model for Madam and call it. ○ Double the sensitivity with oil. Acme who is completely delighted by being struck by a big cock.

  • amateur censoredcreampiemarried womanhmdnhmdn-355hmdn355328hmdn-355
    • 2021-05-08
    122 min

    [XRL-005]Disciplining A Beautiful Young Wife With Debt Problems With Dirty Talk Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobsingle workXRLreal worksreal real worksXRL-005XRL005xrl00005
    • 2021-05-21
    119 min

    [JUL-578]Madonna "Dengeki Transfer" Part 2!! After My Husband Tries To Get Me Pregnant, My Father-in-law Always Follows Up By Filling My Pussy With His Own Cum... Kana Yume

  • kana yui censoredcreampiemature womanJULmadonnajotaro tomiJUL-578JUL578jul00578
    • 2021-06-12
    150 min

    [TPIN-004]Strip Club New Meguro DX Super Secret Sex Service 2021 Spring Performance

  • censoredcreampieblowjobTPINchinpoinTPIN-004TPIN004tpin00004
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-13
    71 min

    SDJ-008 Ayumi

  • amateur censoredcreampiebig titssdjsdj-008sdj008sdj-008
    • 2021-08-14
    60 min

    SIRO-4563 [First Shot] [Style ○ × Skin Quality ○ × Reaction ○] [Slutty Serious Girl’S Foolery] A 19-Year-Old Moody Beautiful Girl Who Aims To Become A Veterinarian Appears. Her Sensitive Young Skin Makes Her Cute Roar To Her Hard Roots And Erect

  • amateur censoredamateursirosiro-4563siro4563siro-4563
    • 2021-08-20
    235 min

    [REXD-380]The Fragrance of Incense: Barely Legal Girls Get Hysterical At A Seance!

  • censoredcreampieuniformREXDreddogroupREXD-380REXD380rexd00380
    • 2021-08-24
    42 min

    508HYK-012 Ikeike Sister ＃ 12 Nene 2 Ikeike Sister Personal Shooting

  • amateur censoredcreampiebig titshykhyk-012hyk012508hyk-012
    • 2021-09-06
    53 min

    292MY-496 Uehon Nozomi 2

  • amateur censoredcreampiemarried womanmymy-496my496292my-496
    • 2021-09-11
    125 min

    [NSFS-023]Your Most Hated Individual... Loving Wife Gets Licked Down By Terrible Boss. Kanna Hirai

  • shiori hirai censoredmature womansingle workNSFSnagae styletomitake taroNSFS-023NSFS023nsfs00023
    • 2021-09-18
    102 min

    390JAC-114 [Superb Style X Tall 169 Cm X 4 Raw Squirrels] Angel’S Smile And Melody! I’ve Seen Such A Cute Girl! ？？ Sensitive Body Is Squirming Tide Every Time It Pokes! Creampie At The Small Devil’s Explosive Erotic Cowgirl! !! It Feel

  • amateur censoredcreampieamateurjacjac-114jac114390jac-114
    • 2021-09-18
    66 min

    FC2PPV 2217530 [Restore] Deleted Account Video File.0033 "Blowjob, Titty Fuck, Raw Saddle, Cum Eating * Danger Outflow * Former Big Breasts Gravure Idol.

  • amateur uncensoredfc2
    • 2021-10-07
    120 min

    [GS-407]The Best Option For Extreme Service! Micro Bikini Selfie Photo Event. Big Tits Model Shows Off In Her Micro Bikini With Hot Selfies For This Photo Event!

  • censoredblowjobGSsosoru garcontanburaGS-407GS407h-101gs00407
    • 2021-12-02
    105 min

    [AARM-039]Can You Take My Cum In Your Smooth Sweet-Smelling Armpit？

  • mai minamata nonomiya ran censoredbig titshandjobAARMaroma kikakuhamu oujiaromaAARM-039AARM039aarm00039
    • 2021-12-04
    136 min

    [PKPD-171]A Sleepover At A Girl"s House Documentary Spend The Night At Doe-Eyed And Pretty Erika-chan Ai"s House For The Night, And Experience What It Must Be Like To Be Her Boyfriend Erika Ai

  • love erika censoredcreampiesingle workPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-171PKPD171pkpd00171
    • 2021-12-10
    197 min

    [SSIS-270]Yuua Mikami"s Devilish 200 Minutes of All Round Nipple Licking, Teasing and Kneading

  • yua mikami censoredbig titsslutSSISs1 no 1 stylezampaSSIS-270SSIS270ssis00270
    • 2021-12-31
    48 min

    10musume 010122_01 Happy New Year! I Came To Cleanse Your Penis For The New Year Kozue Kurihara

  • amateur uncensored10musume
    • 2021-12-31
    119 min

    [MIAA-555]I Got An Erection When I Saw My C***dhood Friend Who Helps Me Being Fucked By A Bully Luna Tsukino

  • tsukino luna censoredcreampieschoolgirlMIAAmoodyzzack araiminna no kikatanMIAA-555MIAA555miaa00555
    • 2021-12-31
    94 min

    [SSPD-167]Original Work. Oniroku Dan. Married Women Sacrifices. In Ropes. Yu Kawakami

  • yu kawakami morino morino yuuki mochizuki censoredsingle workSSPDattackerskaisuper specialSSPD-167SSPD167sspd00167
    • 2021-12-31
    156 min

    [WAAA-130]The Condom Breaks, And I"m Fucked Alive! A Super Accelerated Piston Makes Her Cum Over And Over Again! Momo Minami

  • minami peach censoredcreampiebig titsWAAAwanz factorywanzWAAA-130WAAA130waaa00130



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored