jav censored javcensored handjo delusion grou




FC2AUKGAPODSQTEHNDNACRSHKDSSISSSNIMIDVADNPPPDABWMILKHZGDWAAANATRCESDEBODMVSDMIDE

2020-09-27
243 min

[GAV-052]Gal Pussy Licking Legend PART. 2

  • censoredcreampieamateurGAVprestigetoy girlGAV-052GAV052gav00052
    • 2020-10-05
    48 min

    FC2PPV 1523617 Flashman’s video [Favorite daughter extra edition] * Namba Su * ba_blindfold (another angle video)

  • amateur uncensoredfc2
    • 2020-10-15
    58 min

    [orec-618]すず

  • amateur censoredcreampiebig titsorecorec-618orec618orec-618
    • 2020-10-22
    240 min

    [SW-735]"My Boyfriend Is S******g, So Go Ahead And Stick Your Rock Hard Cock Into Me" This Elder Sister Type Came To Visit Her Boyfriend In The Hospital, And I Was S******g In The Next Bed, And Since I Was Unable To Have Any Sex While I Was H

  • censoredSWswitchSW-735SW7351sw00735
    • 2020-10-25
    128 min

    [XVSR-558]During My Husband's Work Trip... Married Woman NTR - Made To Cum For 26 Hours Straight By The Neighbor - Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-558XVSR558xvsr00558
    • 2020-11-06
    47 min

    [gerk-318]カホ

  • amateur censoredamateurslutgerkgerk-318gerk318gerk-318
    • 2020-11-12
    102 min

    [hoi-143]なみ(23)

  • amateur censoredamateurbeautiful girlhoihoi-143hoi143hoi-143
    • 2020-11-26
    97 min

    [hoi-147]堀北(21)

  • amateur censoredamateurbeautiful girlhoihoi-147hoi147hoi-147
    • 2020-11-27
    40 min

    359TYVM-107 Dripping busty beauty witch wife squirting acme creampie sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-107tyvm107359tyvm-107
    • 2020-12-07
    48 min

    [gerk-333]ありさお姉ちゃん

  • amateur censoredcreampieamateurgerkgerk-333gerk333gerk-333
    • 2020-12-19
    26 min

    H4610 ki201219 piddle

  • amateur uncensoredh4610
    • 2020-12-25
    216 min

    [SKMJ-137]College Girl Amateurs Clean Filthy Cocks With Their Own Holes! With The Tip Lovingly Scrubbed By The Back Door This Huge Cock Is Shoved Into Her Dripping Pussy For The Rinse Cycle! Then All The Way To Her Womb For Some Hard Pounding Creampi

  • censoredcreampieamateurSKMJred face girlone topSKMJ-137SKMJ137h-1324skmj00137
    • 2020-12-29
    97 min

    451HHH-015 AV first experience [Pant voice and Toro face] [Constant estrus] [Sloppy upper and lower mouths] Beautiful girl with fair skin and nice Shioume boobs and legs! It’s a way of speaking like a fluffy mystery, but the contents are just a

  • amateur censoredcreampiesquirtinghhhhhh-015hhh015451hhh-015
    • 2021-01-01
    40 min

    [opcyn-135]りん(19)

  • amateur censoredcreampieamateuropcynopcyn-135opcyn135opcyn-135
    • 2021-01-08
    120 min

    [GS-370]This Gal At A Hotly Rumored Men's Massage Parlor Is Young And Pretty And Good To Go, And The Word Is That She'll Provide Deep And Rich Service, So I Took A Pill That Would Get My Dick Rock Hard And To My Surprise, Things Took A Divine

  • censoredGSsosoru x garconred ballGS-370GS3701gs00370
    • 2021-01-08
    47 min

    FC2PPV 1637514 * Uncensored * Appearance! !! !! It’s a mass production of thanks for the service SEX of the former J ○ L flight attendant ♡ There is a luxury purchaser privilege!

  • amateur uncensoredfc2
    • 2021-01-21
    151 min

    Caribbeancom 012121-001 Loli Girl Anthology Mihono, Mao Sena, Wakaba Onoue, Riko Tabe, Nagisa

  • mihono mao uncensoredcreampiehandjobcaribbeancom
    • 2021-01-29
    50 min

    FC2PPV 1659821 [No] Spree a teenage girl with an old man’s cock! Inject sperm into the mouth and pussy respectively! It’s Eloy without a bottom, Aya-chan! The best meat urinal! !! 【selfie】

  • amateur uncensoredfc2
    • 2021-01-30
    107 min

    [RD-1039]This Employee Is Getting Rock Hard For His Sexy Fifty-Something Lady Boss, And Now He's Gone Insane ... "Don't You Like Me？ I'm A 55-Year Old Lady, Is That Not Good Enough For You？"

  • madoka censoredmarried womanblowjobRDathena videomurayamaathenaRD-1039RD1039149rd01039
    • 2021-02-04
    88 min

    [REBD-531]Mahiro 2: I'm Home! Mahiro Tadai

  • mahiro yui censoredsingle workREBDrebeccachikara sawamuraREBD-531REBD531h-346rebd00531
    • 2021-02-06
    29 min

    210AKO-416 2nd IKU

  • amateur censoredsquirtingamateurakoako-416ako416ako-416
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-17
    13 min

    S-Cute 817_mone_02 I took a picture of her blowjob in the bathroom / Mone

  • mone censoredamateurmonemone-02mone02817-mone-02
    • 2021-02-21
    165 min

    [HND-946]When I Started To Gasp For Air, She Covered My Mouth With Slobbering Kisses And Even When My Cock Started To Bug Out, She Wouldn't Stop Pounding Me With Piston-Powered Creampie Thrusts Because She Was A Kissing Cowgirl Elder Sister Type

  • mitani akari censoredcreampieslutHNDhon nakanao masakiHND-946HND946hnd00946
    • 2021-03-04
    160 min

    [GS-2009]Married Woman Hot Water Love Trip 138

  • asamiya chinatsu censoredmarried womanGSgostakeshi karakiGS-2009GS2009
    • 2021-03-04
    184 min

    [SHIND-004]A Relentless Pervert Rides The Maso Train Home Invasion Record #7 8

  • censoredamateurSHINDshinkirousuzuki o maSHIND-004SHIND004h-1560shind00004
    • 2021-03-05
    115 min

    [PARATHD-3124]A Wife With Big Tits Who Was Continuously Fucked By Her Father-in-law, Whom She Hates, For 3 Days While Her Husband Was Away On A Business Trip

  • censoredcreampiebig titsPARATHDparadise tvPARATHD-3124PARATHD3124parathd03124
    • 2021-04-21
    67 min

    FC2PPV 1779365 [500pt off for a limited time] ＃ 24 Private Icharab sex for the first time since dating ❤ "Do you want to say it？ (〃 ﾉ ω ﾉ) From the first time I passed away, I was conceived with a lot of love and vaginal cum shot ❤

  • amateur uncensoredfc2
    • 2021-04-24
    152 min

    [JUKF-060]This College Girl Did As She Was Told By Her Parents And Went On To College In Tokyo And Found Herself Getting Involved With A Dating App, Casually, Like Getting A Part-Time Job (And Going For Some Sugar Daddies) Mao-chan Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsJUKFjumpjump avJUKF-060JUKF060h-227jukf00060
    • 2021-05-07
    120 min

    [EBOD-822]Former Idol's Porn Baptism! A Real Idol Gets Nailed In Front Of Her Real Fans With Nasty Orgasms Ami Yozora

  • ami yozora censoredbig titssquirtingEBODe bodytrendy yamaguchiEBOD-822EBOD822ebod00822
    • 2021-05-20
    123 min

    [FSDSS-227]FIRST FALENO Shocking Transfer Release Special Minamo Nagase

  • minase nagase censoredbig titssquirtingFSDSSfalenomusetafaleno starFSDSS-227FSDSS2271fsdss00227
    • 2021-05-20
    180 min

    [SVDVD-859]Night Ward Sex 5 - When The New Young Nurse Came To Check On Me At Night, I Ripped Her Clean White Uniform Right Off And Fucked Her Raw!!

  • ayaka mochizuki ayano suzuju censoredcreampiebig titsSVDVDsadistic villagekogoro kindaichibanging girlsSVDVD-859SVDVD8591svdvd00859
    • 2021-05-22
    67 min

    HEYZO 2530 Foursome Fantasy With A Plump Girl! – Riri Shiraki

  • riri shiraki uncensoredcreampieheyzo
    • 2021-05-23
    116 min

    241GAREA-512 Suwan

  • amateur censoredamateurbeautiful girlgareagarea-512garea512241garea-512
    • 2021-05-25
    65 min

    229SCUTE-1117 Mikako (23) S-Cute Facial Cumshot SEX Of A Devilish Uniform Beautiful Girl

  • amateur censoreduniformamateurscutescute-1117scute1117229scute-1117
    • 2021-06-29
    48 min

    274DHT-0081 Gonzo Immediately Gonzo Intoxicated A Geki Kawa Girl Captured On The Street Mirei 21 Years Old

  • amateur censoredamateurbeautiful girldhtdht-0081dht0081274dht-0081
    • 2021-07-01
    241 min

    [CUBEX-002]Absolutely Nut-Busting Raw Fuck Collection 2 - Picking Up Hot Busty Office Girl Amateurs On Vacation 4 Hours

  • censoredcreampiebig titsCUBEXcubeCUBEX-002CUBEX002h-1593cubex00002
    • 2021-07-08
    240 min

    [DOCP-305]ヒミツの夜のKEN(県)JIN(人)SHOW！！47都道府県の変態ガールたちの夜の営み大解剖！！

  • amateur censoredcreampiesquirtingdocpdocp-305docp305docp-305
    • 2021-07-14
    122 min

    [MVSD-473]Sex At The Hospital - Paid Service To Unstop Patients' Backed Up Seed Mikako Horiuchi

  • mikako horiuchi censoredcreampiebeautiful girlMVSDm s video groupMVSD-473MVSD473mvsd00473
    • 2021-07-24
    185 min

    [JKSR-501](A Furious Tremor) These Marshmallow-Soft Big Tits Are Dropping Like A Bomb!! We Gave This Married Woman A Good Time And Some Semen To D***k @Shinjuku Married Woman Babes From The Country Only We Seduced This Married Woman Who Seemed To Hav

  • censoredamateurJKSRbig morkalprink junkyJKSR-501JKSR50157jksr00501
    • 2021-07-31
    120 min

    [BKD-268]Stepmother and Offspring Mating [Yataro Yamaro] Arisa Habu

  • arisa hanyu arisu hanyu censoredmature womansingle workBKDrubytsuji koujitabijiBKD-268BKD268bkd00268
    • 2021-08-02
    116 min

    503KOO-017 Miu

  • amateur censoredbig titsamateurkookoo-017koo017503koo-017
    • 2021-08-06
    138 min

    [HODV-21594]For My Use Only! Fucking Sluts Who Have Colossal Tits: Mating With, And Raising, As I Like Colossal Tits Girls Who Run Away From Home. Riina Asuka.

  • asuka riina censoredcreampiebig titsHODVh m pbottomsHODV-21594HODV215945642hodv21594
    • 2021-08-07
    99 min

    [VEMA-151]I Was Working This Part-Time Job And The Old Lady Who Helped Me Out Was Getting Creampie Fucked, And I Got An Erection Watching Her Get Banged Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanVEMAvenuskaniemegami venusVEMA-151VEMA151vema00151
    • 2021-08-10
    147 min

    [KIRE-054]I Want To See A Beautiful Woman Falter. Quickie Right After Arriving! Unending Fuck No Matter How Much She Cums! Hinano Okada

  • hinano okada censoredsingle workKIREsod createu kichirei kirei sodKIRE-054KIRE0541kire00054
    • 2021-09-05
    70 min

    200GANA-2550 Seriously Nampa, First Shot. 1685 Picking Up A Sad Older Sister Who Was Made To Meet With A Matching App! Obedient Service! Licking A Smiling Ball! The Reaction After Insertion Is Also Good! Butch Man, You Did Something Unreasonable! !!

  • amateur censoredamateurganagana-2550gana2550200gana-2550
    • 2021-09-08
    105 min

    241GAREA-519 Miu

  • amateur censoredcreampiebig titsgareagarea-519garea519241garea-519
    • 2021-09-10
    240 min

    [HUNTB-089]"Stop It, Big Bro" "No, That"s "Master" To You!" My Stepsister Got A Job Working At A Maid Cafe, So I Taught Her How To Handle Come-Ons From Customers - Her Reactions Are Totally Adorable

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-089HUNTB089huntb00089
    • 2021-09-11
    109 min

    [APNS-256]A Bunkhouse Female S*****t To Process Your Libido - Suzu Takayama

  • takayama tin censoredcreampieschoolgirlAPNSaurora project annexnasu yukihiroAPNS-256APNS256apns00256
    • 2021-09-16
    55 min

    10musume 091821_01 I Was Introduced To A G-Cup Busty Girl With A Cute Face Mirai Hayase

  • amateur uncensored10musume
    • 2021-09-17
    156 min

    [MIFD-180]She Loves Pizza! She Loves Sex! An AV Debut That Allows Her To Do Everything She Loves! Nanami Shiozaki

  • nanami shiozaki censoredblowjobbeautiful girlMIFDmoodyzkubo stylemoodyz freshMIFD-180MIFD180mifd00180
    • 2021-09-29
    58 min

    491TKWA-192 H Cup Big Tits J ● And 3P Cum Inside! (Riho Takahashi)

  • amateur censoredcreampiebig titstkwatkwa-192tkwa192491tkwa-192
    • 2021-11-11
    57 min

    FCP-052 [Delivery Only] I Love Subjectivity! !! Be Careful Too Much! !! No Waiting For Ejaculation With Amazing Rerorero Belochu Handjob! 4 (Sakura Tsukino, Saya Matsui, Rin Miyazaki)

  • amateur censoredamateurbeautiful girlfcpfcp-052fcp052fcp-052
    • 2021-11-12
    119 min

    [MUDR-168]Three Days in Hell Experienced By One Girl. Nightmare At the Altar. Small S&M Offering. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredschoolgirlbdsmMUDRmukuMUDR-168MUDR168mudr00168
    • 2021-11-13
    94 min

    534IND-010 Class 1 Beautiful Girl J ○ Has Outstanding Sensitivity 2 Shots Creampie Video Leaked To Paipanma Co ○ (Maina Miura)

  • amateur censoredcreampieamateurindind-010ind010534ind-010
    • 2021-12-04
    53 min

    C0930 hitozuma1368 Fusako Yokoyama 29years old

  • amateur uncensoredc0930



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored