jav creampie censored petite devil




FC2MIDVBLKJULAUKGGMEMAVSANACRWANZAWDNGODROYDWAAAPREDDASDCESDMIAAPPPDMIDEKBIAUKG

2020-10-13
58 min

345SIMM-529 Misaki / 18 years old / Super brother Love ☆ Nasty sister

  • amateur censoredcreampieschoolgirlsimmsimm-529simm529345simm-529
    • 2020-10-21
    45 min

    107HISN-012 [Distribution Exclusive] SOD Rookie AV Debut Hibiki Otowa (21) Gokujun Vacuum

  • amateur censoredamateurbeautiful girlhisnhisn-012hisn012107hisn-012
    • 2020-10-30
    80 min

    HEYZO 2391 Loli Amateur Girl Got Massive Squirting Orgasm -College Girl Reina(21) Returns- – REINA

  • reina uncensoredheyzo
    • 2020-11-01
    59 min

    [HKHS-004]Miami Nampa Seductions Light Skin x Chubby Big Tits A Secretly Horny Kindergarten Teacher Eliza (23 Years Old)

  • censoredcreampiebig titsHKHShikara delusion grouphollywood saburoHKHS-004HKHS004hkhs00004
    • 2020-11-05
    114 min

    [FERA-123]Family Fun With A Mom Who Let Me Put It In, Just The Tip - Shihori Akiyama

  • akiyama shiori censoredcreampiemature womanFERAcenter villagefukagawa jirourakuen center villageFERA-123FERA123h-086fera00123
    • 2020-11-16
    17 min

    FC2PPV 1572566 [I will release my masturbation for side dishes without permission] Famous car show ☆ Race queen experience ☆ Lotion Bechobecho White Skating Clothes Man Juice Bicho Bicho Rotor Masturbation ❤ Pussy close-up shooting! !!

  • amateur uncensoredfc2
    • 2020-11-19
    110 min

    [DDT-642]Deep Throat: Throat Education - Alice Toyonaka

  • alice toyonaka censoreddeepthroatsingle workDDTdogmatohjiroDDT-642DDT642ddt00642
    • 2020-11-27
    120 min

    [SGM-046]When I Was Stuck Alone With My Female Superior In The Company Building During A Stormy Night Kurea Hasumi

  • hasumi claire censoredbig titsSGMglobal media entertainmentkikuji akabanesuper global mediaSGM-046SGM046143sgm00046
    • 2020-11-28
    120 min

    [HMNF-071]World Express, Bullet Tour - Sex And Titties Nonoka

  • is it censoredsingle workHMNFhmjmcompany matsuonon fictionHMNF-071HMNF071h-172hmnf00071
    • 2020-12-05
    121 min

    [NGOD-138]The Japan National Cuckold Awards Grand Prize Winner This Married Woman Works In Business Affairs, And When I Had Her Deal With An Annoying Client's Complaints, He Made Unreasonable Demands Of Her, And Made Her Strip, And Fondled Her, A

  • haruna hana censoredmature womansingle workNGODjet eizomanji groupNGOD-138NGOD138ngod00138
    • 2020-12-18
    66 min

    FC2PPV 1610957 ☆ 600pt OFF until December 24th for a limited time! !! !! [None / Piece] The second healing chubby nerd Mami-chan! !! I was too gluttonous and did it while eating pizza ♪ * There is an appearance review privilege

  • amateur uncensoredfc2
    • 2020-12-25
    120 min

    [NEM-050]The New Abnormal Sex - MILF In Her Fifties Part 22 - Stepmom Watches Her Stepson Jerk Off To Get To Know Him Better Seiko Nagata

  • shigeko nagata censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-050NEM050143nem00050
    • 2020-12-26
    112 min

    390JAC-073 [God Iki Goddess x Big Breasts H Cup x Raw Saddle 4 Barrage] “My wish is to squeeze all sperm” Ultimate H huge breasts gal who fell down on the gal! !! Explosion! convulsions! Great cum! I repeat it over and over again! !! I don&

  • amateur censoredcreampiebig titsjacjac-073jac073390jac-073
    • 2020-12-27
    42 min

    H4610 ki201229 Ren Aoyama 25years old

  • amateur uncensoredh4610
    • 2021-01-16
    34 min

    [HHKL-080]Usually, I Never Have Any Sexual Feelings Towards My Little Stepsister, But When I Saw Her For The First Time In Her Team Uniform, Her Bulging Ass Was Just Too Sexy For Me To Resist! Karen Otoha

  • karen otoha censoredbig titssisterHHKLhunterkonjac kanohhh groupHHKL-080HHKL080hhkl00080
    • 2021-01-24
    130 min

    [ANZD-058]This Babe's Day Job Is Stuff At A Famous Massage Parlor I The City! She Pisses Herself With Pleasure x Multiple Orgasms x Raw Creampie Sex! Satomi

  • censoredcreampieamateurANZDanzu daydream vacationanzuANZD-058ANZD058anzd00058
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    39 min

    [ore-751]アユミ

  • amateur censoredcreampiebig titsoreore-751ore751ore-751
    • 2021-02-20
    65 min

    SIRO-4433 [First shot] [Face deviation value SS class] [Erogenous zone in the back of the vagina ..] Super beautiful office lady who entered a major company as a new graduate. She will be imagined by everyone in the company Her foolery is .. AV appli

  • amateur censoredamateursirosiro-4433siro4433siro-4433
    • 2021-02-23
    140 min

    [SDTH-002]She's Cum Swallowing 20 Shots Of Cum, All Outdoor! This Maso Bitch Amateur Pretends To Be Prim And Proper, But She'll D***k Down That Cum With A Smile, And Here She Is, Again. From The *** Shopping District In Setagaya, Tokyo A 2nd-

  • censoredSDTHsodafro takahashieromanSDTH-002SDTH0021sdth00002
    • 2021-02-26
    92 min

    SNYZ-020 Aria-chan 2

  • amateur censoredamateurcosplaysnyzsnyz-020snyz020snyz-020
    • 2021-03-11
    81 min

    200GANA-2437 Seriously Nampa, first shot. 1608 The stress of breaking up with your boyfriend is released on SNS! Please cheat the older sister who exposes her H figure and satisfies the approval desire! I will forgive my body by being pierced by a ga

  • amateur censoredbig titsamateurganagana-2437gana2437200gana-2437
    • 2021-03-18
    141 min

    [HUNTA-967]At The Cultural Fair, The Year 3 Class 6 Team Put Out Their Special Booth ... The Haunted House. Welcome To The Cultural Fair At A School For Young Ladies. At This Super Popular Booth, Where People Are Lining Up Around The Block, "Visi

  • censoredcreampieschoolgirlHUNTAhuntermasanorihhh groupHUNTA-967HUNTA967hunta00967
    • 2021-03-18
    211 min

    [HUNTA-969]"If You Promise To Keep It A Secret, I'll Let You Do Whatever You Want With Me ..." I Was Refusing To Go To School, But I'm The Only One Who Knows That This Super Prim And Proper School Council President Is Secretly A Horny

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-969HUNTA969hunta00969
    • 2021-04-14
    47 min

    FC2PPV 1770213 Up to 21 1480 [None] A fair-skinned JD toy with a big butt. There is no escape in a closed room, and the vagina is forcibly fucked and pregnancy juice is …

  • amateur uncensoredfc2
    • 2021-05-01
    118 min

    [JUL-569]"When You Look At Me With Such Moist, Sexy Eyes, You Make Me Want To Fuck You." I Was Always Infatuated With This Beautiful Married Woman, And She Begged Me For Help As She Was Being Fucked, And I Got So Excited Watching Her Get Bang

  • hojo asahi censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-569JUL569jul00569
    • 2021-05-07
    108 min

    [FTHT-013](An Endless Loop Of Deep Throat Dick Sucking! Furious Chain Reaction Of Piston-Pumping Reactions" Unstoppable Pissing!) A Baby-Faced Babe With Big Tits Is Relentlessly And Continuously Getting Her Throat Skewered With Cocks! Suffocating

  • censoredcreampiebig titsFTHTfalenodavielfalenotubeFTHT-013FTHT0131ftht00013
    • 2021-05-14
    125 min

    [ARM-978]Raunchy S********ls Masturbate While Showing Off Their Stained Wet Panties

  • otohana eve hazuki peach censoredschoolgirlARMaroma planningmania satoshiaromaARM-978ARM978arm00978
    • 2021-05-16
    98 min

    300MIUM-713 [Ultimate God Style] This thin and H cup is really! !! ？？ ？？ Rent a huge breasts apparel designer as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoying Atami&#

  • amateur censoredcreampiebig titsmiummium-713mium713300mium-713
    • 2021-06-01
    59 min

    1Pondo 060121_001 Seducing by Flashing Pussy: Nagisa Shinohara

  • amateur uncensored1pondo
    • 2021-06-05
    59 min

    H0930 ori1603 Takae Sasamoto 33years old

  • amateur uncensoredh0930
    • 2021-06-15
    58 min

    [061521_001]親友の彼女 立花かおり

  • amateur uncensored1pondo
    • 2021-07-02
    166 min

    [SSIS-104]* Absolutely No Script!! POV Fuck! No Makeup! It's All Here! The True Dirty Nature Of Saki Okuda Is Revealed In This Exposed Fuck Session!! A Super Rare Film Of This Real Couple's Hot Spring Trip With Nonstop Fucking, Too Raw And Sh

  • saki okuda censoredbig titssingle workSSISs1 no 1 stylearashiyama michiruSSIS-104SSIS104ssis00104
    • 2021-07-05
    56 min

    328HMDN-379 Gonzo Outflow Of A G-Cup Softball Female Baseball Player Belonging To A Business Group! God swings the penis with your mouth and pussy while squeezing a too erotic body

  • amateur censoredbig titsamateurhmdnhmdn-379hmdn379328hmdn-379
    • 2021-08-05
    83 min

    374IMGN-018 An (20)

  • amateur censoredamateurbeautiful girlimgnimgn-018imgn018374imgn-018
    • 2021-08-07
    260 min

    [MDTE-011]I Met Up With An Erotically Cute Currently Active College Girl On This Divine App, And We Enjoyed 4 Hours Of Creampies, In The Raw 05

  • censoredcreampiebeautiful girlMDTEspace planningtetMDTE-011MDTE011mdte00011
    • 2021-08-08
    14 min

    10musume 080821_01 I’Ll Make You Feel Good By My Mouth, So I Hope This Might Cheer You Up？ Yu Nagata

  • amateur uncensored10musume
    • 2021-08-21
    77 min

    200GANA-2541 Seriously Nampa, First Shot. 1679 Picking Up A Show Bread Gal That You Will Fall In Love With Long And Plump Legs! When You Beloch, There Is A Nasty Thread On The Sexy T-Back …

  • amateur censoredsquirtingamateurganagana-2541gana2541200gana-2541
    • 2021-09-04
    114 min

    [HOKS-102]Me And My Uncle"s Impure Fucking

  • nagaoka mao tajima censoredschoolgirldramaHOKSfa pro platinumogurokku kinzoufa proHOKS-102HOKS102hoks00102
    • 2021-09-07
    131 min

    [090721_001]セクシー女優スペシャル版 ～ 鈴木さとみ 舞咲みくに～

  • amateur uncensored1pondo
    • 2021-09-17
    172 min

    [JUNY-043]Dirty Men Toy With Curvy Bodied Girl Even While Her Boyfriend Is Right There. Colossal Tits And Massive Ass In Swimsuit Gets Teased By Personal Trainer. Climax NTR Getting Cheated On Pervert. Reo Fujisawa

  • reo fujisawa censoredbig titssingle workJUNYfitchnikuyokuJUNY-043JUNY043juny00043
    • 2021-09-21
    120 min

    [SAN-021]Fucked By Husband"s Boss! Peach Ass And Big Tit Nipples Defiled, And She"s Fixated On His Cock, Mana Kuroi

  • kuroi aina censoredcreampiebig titsSANmazaisland watakanomother mazaSAN-021SAN021h-796san00021
    • 2021-09-23
    199 min

    [NHDTB-581]She Sneaks My Cock Inside While Giving Me A Massage Next To My Wife Cowgirl Creampies With An Esthetician 4

  • censoredslutNHDTBnatural highkansukeNHDTB-581NHDTB5811nhdtb00581
    • 2021-10-02
    139 min

    [MMUS-057]Small, Devilish And Provocative Beautiful Girl - Ena Satsuki

  • ena satsuki censoredbeautiful girlslutMMUSmarrionkasai kijinkcpMMUS-057MMUS057mmus00057
    • 2021-10-10
    35 min

    FC2PPV 2327375 * None * Living In Tohoku (23) Creampie Training In Eloy Costume In Black Tights Day 2 (Fixed Ver) ☆ Review Privilege Is G Cup Beautiful Breasts Fucking ♡

  • amateur uncensoredfc2
    • 2021-10-29
    139 min

    [MMND-202]"Excessive Filming" Nanami Ogura A 19-Year Old Innocent Babe With F-Cup Tits And A Voluptuous Body A Sakamichi-Style, Pure And Beautiful Girl

  • nanami ogura censoredbeautiful girlsingle workMMNDmimaniwasawa yukiMMND-202MMND202mmnd00202
    • 2021-11-12
    243 min

    [SKMJ-225]These Amateur Girls Are Visiting The Home Of A Maso Man! These Innocent Girls Had Practically No Experience In The Art Of Making The First Move, But When His Endless Maso Soul Touched Their Hearts, It Triggered The Blossoming Of Their Sadis

  • censoredcreampieamateurSKMJblush girlxyzSKMJ-225SKMJ225h-1324skmj00225
    • 2021-11-20
    131 min

    [CEMD-087]I"m Sorry I Peed So Much...32 Hana Hakuto

  • white peach censoredmature womansingle workCEMDceleb no tomoCEMD-087CEMD087cemd00087
    • 2021-12-04
    310 min

    [HOIZ-033]Cum Cum The Lover 3 Amateur Cum Cum Z / A Private Video Session / Beautiful Girl / Hookup App / POV / Amateur / SNS / Cum Face / 2 Ejaculations / Big Tits / Neat And Clean / Elder Sister Type / College Girl / Lover / Sugar Daddy Hunting

  • censoredbig titsamateurHOIZamateur seduction daydream familyHOIZ-033HOIZ033hoiz00033
    • 2021-12-05
    65 min

    TMEN-001 Alice (Nozomi Alice)

  • amateur censoredcreampiebig titstmentmen-001tmen001tmen-001
    • 2021-12-11
    120 min

    [REAL-784]Reliving A Memory Over And Over As Soon My Body Is Taken... Flash Back To Being Taken Advantage Of. Himari Kinoshita

  • himari kinoshita himari hanazawa censoreddeepthroatsingle workREALreal worksjohnny shibuyareal real worksREAL-784REAL784real00784
    • 2021-12-21
    61 min

    [122121_574]万引き主婦の結末

  • amateur uncensoredpacopacomama
    • 2022-01-07
    120 min

    [SSIS-291]Only Cum Right in Front of Me! Girlfriend Tells Me How to Cum Each Time, How Much Cum and When to Cum. miru.

  • miru censoredblowjobsingle workSSISs1 no 1 styleinaballSSIS-291SSIS291ssis00291
    • 2022-01-21
    29 min

    FC2PPV 2608267 Insanely Cute [Sister Can System] I Invited An Amateur Student To Drive At Night And Made Him Blow In The Car! Turn Into A Private Suite Room With No Hand Blow Job

  • amateur uncensoredfc2
    • 2022-01-27
    127 min

    [JRZE-098]First Time Filming My Affair. Naho Fujikawa.

  • fujikawa naho censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-098JRZE098h-086jrze00098
    • 2022-02-19
    173 min

    [LZPL-063]Kokono Terada Gives It Up For Her First Lesbian Experience. She Gets Tied Up, Undergoes Lesbian Training, Gets Her Thing Played With, Pees, And Cums.

  • terada here yano tsubasa censoredbig titssquirtingLZPLlesreultimate ryolezure playLZPL-063LZPL063lzpl00063



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored