jav def javcensored other fetishes over hours




FC2SANVENUSQTEKSBJFSDSSHDKASTARSGVHWAAASPRDGMEMCHRVKBICESDNGODEBODJULONEZROYDAVSA

2020-10-31
115 min

[MIAA-342]Pregnancy Fetish With My Lovely Girlfriend: Listening NTR - Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingMIAAmoodyzzack araiminna no kikatanMIAA-342MIAA342miaa00342
    • 2020-11-02
    65 min

    [KBTV-038]Theory: If I Just Keep Sweet-Talking This Incredibly Plain Girl, Will I Eventually Get To Fuck Her？

  • censoredamateurblowjobKBTVmessy tvKBTV-038KBTV038h-1514kbtv00038
    • 2020-11-12
    81 min

    [opcyn-118]あおい(26)

  • amateur censoredamateuropcynopcyn-118opcyn118opcyn-118
    • 2020-11-13
    47 min

    [CRNX-007]Sexless Before They Knew It... Breaking In These Middle-Aged Men For A Second Time Vol. 1 Miku Abeno

  • miku abe censoredcreampieblowjobCRNXcrystal picturekintaro okumacrystal nextCRNX-007CRNX00749crnx00007
    • 2020-11-19
    112 min

    [BBTU-002]Titty Fuck With A Masochist H-cup married Woman: Titty Fuck Sex Mako Oda

  • oda mako censoredbig titsmature womanBBTUdogmatenunmy big titsBBTU-002BBTU002bbtu00002
    • 2020-11-20
    28 min

    [BTH-088]I Want You To Kiss Me While Putting It In - Yura Kokona

  • yoko kokoro censoredBTHchobitchchovicBTH-088BTH088h-1435bth00088
    • 2020-11-25

    FC2PPV 1583663 * Limited [Uncensored] A fair-skinned simple girl who came to Tokyo from the countryside. Continuous ejaculation-drinking (45 minutes)

  • amateur uncensoredfc2
    • 2020-11-27
    65 min

    417SRCN-054 [Love hotel reception girl] An older sister with a relaxed atmosphere works hard to support the virgin ED Ji ● Po! Completely erected Ji ● Po reward SEX! [Onasapo]

  • amateur censoredcreampieamateursrcnsrcn-054srcn054417srcn-054
    • 2020-12-18
    73 min

    415LAS-033 Ayakan (Ayaka Mochizuki)

  • amateur censoredcreampiebig titslaslas-033las033415las-033
    • 2021-01-08
    132 min

    [RCTD-375]Tokyo Areola 2021

  • nene tanaka tsujii honoka censoredbig titsRCTDrocketroute yamazakiRCTD-375RCTD3751rctd00375
    • 2021-01-09
    125 min

    [HHKL-079]"It Doesn't Matter How Many Times You Fuck Up... Just Keep Practicing With Me!" My Big Tits Big Stepsister Is Slightly Older Than Me, And She's Helping My Cherry Boy Ass To Become A Man!

  • yano tsubasa mihara honoka censoredcreampiebig titsHHKLhuntervolvo nakanohhh groupHHKL-079HHKL079hhkl00079
    • 2021-01-25
    83 min

    [THNIB-068]The White Paper Of A Pure Younger Sister - Teen Glitter - Tomoka Hayasaki

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-068THNIB068h-706thnib00068
    • 2021-02-01
    115 min

    [NACR-390]Busty Art S*****t Asks Her Stepdad To Model Nude And Ends Up Getting So Horny She Takes His Creampie Ran Shiono

  • ran shion censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-390NACR390h-237nacr00390
    • 2021-02-04
    65 min

    SIRO-4409 [First shot] [H size natural huge breasts] [Reason for the meat stick since the ex-boyfriend ..] Big breasts sister who works at a high-class massage shop with touch NG. Her occasional innocent smile was impressive, she hummed unimaginable

  • amateur censoredbig titsamateursirosiro-4409siro4409siro-4409
    • 2021-02-05
    93 min

    380SQB-087 Ena

  • amateur censoredbig titsamateursqbsqb-087sqb087sqb-087
    • 2021-02-06
    240 min

    [HUNTA-940]"I Wanna Try Fucking A Grown Up. Is That Wrong？" "I'm Game" Naughty Step-Uncle Agrees To Sleep With His Barely Legal Niece - He Can't Turn Down The Offer Of A Creampie...

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-940HUNTA940hunta00940
    • 2021-02-12
    134 min

    [KBI-053]She Commits Adultery With Her Naughty Body. A Throbbing, Instantly Cumming, Sensual Maso Body A Former Music Teacher 3 Deep And Rich Fucks!! Minaho Ariga

  • ariga minaho censoredbig titsmature womanKBIprestigesamansa tabatakanbiKBI-053KBI053118kbi00053
    • 2021-02-12
    93 min

    [XRW-976]Giving A Hard Deep Throat Present To A Bondage Beauty Who Climaxes Through Spanking! 2

  • kato momoka mihina azumihina mihina nagai censoreddeepthroatXRWreal worksreal real worksXRW-976XRW976172xrw00976
    • 2021-02-19
    96 min

    [BBTU-007]Crazy Cumming: Big Titted Pursuit - Rui Miura

  • rui miura censoredcreampiebig titsBBTUdogmatenunmy boyneBBTU-007BBTU007bbtu00007
    • 2021-03-06
    138 min

    [JBD-263]Servant Contract - Shihori Kotoi

  • shiori kotoi censoredbdsmsingle workJBDattackersjo asagirijabakuJBD-263JBD263jbd00263
    • 2021-03-11
    54 min

    [GRMO-032]ニンゲン観察 PC修理業者の男があまりにタイプすぎて、ウブな反応をからかううちに思わず誘惑してしまったスケベなお姉さん

  • censoredGRMOmura chblood clam abaloneGRMO-032GRMO032h-1534grmo00032
    • 2021-04-01
    239 min

    [MGR-2102]An All-Japan Sex Tour 4 Hours Kobe/Gotenba/Omiya/Chiba/Hakodate/Tokyo (Akasaka And Ikebukuro) We Had Lots Of Sex With Sexy And Cute Amateur Girls!

  • censoredamateurMGRtm createmomojirimangoMGR-2102MGR2102165mgr02102
    • 2021-04-02
    133 min

    [ARM-966]A Furiously Carnivorous Girl Is Going Elegantly Out-Of-Control For Men's Cocks Ameri Hoshi

  • star ameri censoredsluthandjobARMaroma planninghamu oujiaromaARM-966ARM966arm00966
    • 2021-04-10
    129 min

    [BAHP-074]My C***dhood Friend Wants To Be Submissive Noa Shiina

  • shiina noa censoredbig titssingle workBAHPbaltanusubashisuihoppinBAHP-074BAHP074bahp00074
    • 2021-04-15
    241 min

    [WA-452]Picking Up Girls - Amateur Wives Only! They Offer To Teach Virgin Guys Through Thigh Sex, But It Accidentally Slips Inside And Feels Too Good To Stop - Hard Pounding Creampie Sex

  • censoredcreampiemarried womanWAlotusWA-452WA452h-047wa00452
    • 2021-04-16
    53 min

    509JPAK-008 Momoka

  • amateur censoreduniformschoolgirljpakjpak-008jpak008509jpak-008
    • 2021-04-30
    74 min

    300NTK-561 Urgent insertion delivery! !! The bright erotic squirrel of a natural beautiful girl loved by God explodes! !! I tried to play with a happy bitch toy ♪ has started safely! !! It shouldn’t end with just a toy, and continuous ascension

  • amateur censoredcreampieamateurntkntk-561ntk561300ntk-561
    • 2021-05-10

    FC2PPV 1810325 First shot !! Limited number [Uncensored] D cup that has just become a nursery teacher this spring! ︎ Pretty disturbed back face … 2 times vaginal cum shot (feature)

  • amateur uncensoredfc2
    • 2021-05-18
    57 min

    299EWDX-362 The wife of Binkan, who got married for a year, is so excited that she can eliminate her daily frustration!

  • amateur censoredcreampiemarried womanewdxewdx-362ewdx362299ewdx-362
    • 2021-05-20
    77 min

    [VNDS-3366]Taking Flirty Business Woman Home

  • censoreduniformVNDSstar paradisenext toilet r eVNDS-3366VNDS3366h-254vnds03366
    • 2021-06-10
    129 min

    [MEKO-211]The All-New "Old Lady Rental Service" 14 This Popular Housecleaning Service Will Do Whatever You Ask, Including Creampie Sex, So I Decided To Make An Even More Extreme Request

  • censoredcreampieamateurMEKOmature woman laboMEKO-211MEKO211h-1160meko00211
    • 2021-06-10
    189 min

    [PIYO-118]"I Want My Step Dad's Baby!" The Love Between A Small Step Daughter And Her Step Father Leads To Raw Sex...

  • censoredcreampiePIYOhyokopiero daPIYO-118PIYO1181piyo00118
    • 2021-06-12
    164 min

    [SABA-702]Challenge The Mission - Angelically Sweet Nurse Breaks In A Male Virgin! He Suckles Her Tits While She Gives Him A Handjob! It Starts With Blushing Thigh Sex, Then His Cock Slips Inside SPECIAL vol. 001

  • censoredcreampieblowjobSABAskyu shirototodoSABA-702SABA702saba00702
    • 2021-06-26
    90 min

    300NTK-594 [Animal SEX 3 Consecutive Squeezing] 30 Saffle Regular Dovich GAL! !! The aim is the next-generation SEX symbol! !! Hundred battles of apt … No thousand … No! !! Man battle training sex animal woman on top posture with actor seco

  • sexsex censoredcreampieamateurntkntk-594ntk594300ntk-594
    • 2021-07-30
    168 min

    [PRED-329]W Exclusive Lascivious Woman Special: My Female Bosses Were So Horny On A Company Trip That They Begged Me To Fuck Them Non-stop... Yuki Takeuchi, Mami Sakurai

  • yuki takeuchi mami sakurai censoredcreampieslutPREDpremiumzampaelegancePRED-329PRED329pred00329
    • 2021-08-11
    53 min

    [081121-001][VR] Cream pie SEX with a slut whispering jargon

  • emiri momota uncensoredcreampiecaribbeancom
    • 2021-08-18
    124 min

    [GVH-280]Son-In-Law Sets His Sights On Mother-In-Law"s Slutty Big Tits Mako Oda

  • oda mako censoredcreampiebig titsGVHglory questtakahashi chitsujiGVH-280GVH28013gvh00280
    • 2021-08-20
    89 min

    [HIKR-188]Surf Girl With Big Tits And Ass Gets Picked Up In L.A. And Makes Her Porn Debut By Straddling A Man With Her Obscene Dynamite Body Shaking Hard Violet (23)

  • censoredcreampiebig titsHIKRhikara delusion grouphollywood saburoHIKR-188HIKR188hikr00188
    • 2021-08-24
    60 min

    SIRO-4610 [First Shot] [Highly Aesthetically Pleasing] [Ass With Outstanding Tension] Discovered An Active University Student With A Transparent And Beautiful Naked Body. The Pink Nipples With Outstanding Sensitivity Are Caressed And Dyed Red, And Th

  • amateur censoredamateursirosiro-4610siro4610siro-4610
    • 2021-08-25
    101 min

    459TEN-024 [Hcup Fucking Goddess] Assault On The Home Of An H-Breasted Spear Man Gal Captured In Shibuya! !! Bombshell Fuck With Special Game Underwear! !! Hami Milk That Does Not Fit In The Game Underwear Is Erotic To The Strongest Level Ever! A Sma

  • amateur censoredcreampiebig titstenten-024ten024459ten-024
    • 2021-09-16
    57 min

    FCP-041 [Delivery Only] I Love Subjectivity! !! Be Careful Too Much! !! No Waiting For Ejaculation With Amazing Licking Licking Handjob! 3

  • amateur censoredamateurslutfcpfcp-041fcp041fcp-041
    • 2021-09-17
    150 min

    [MUDR-163]The Day I Took On My Step-niece. Step-sister Edition. Live Action Version. Bratty Step-niece And Her Step-sister Are Served Up For The Taking. Mirei Nitta, Kanna Shiraishi

  • mirei nitta shiraishi plane censoredanalsisterMUDRmukuMUDR-163MUDR163mudr00163
    • 2021-09-25
    140 min

    [MCSR-452]How Many Wive"s Pussies Can I Fill With My Cum？ Hikari Sena

  • hikari sena censoredcreampiebig titsMCSRbigmorkalmasukattoMCSR-452MCSR45257mcsr00452
    • 2021-10-01
    164 min

    [JUFE-334]Thick Colossal Tits Hot Hostess With A Nice Body Is Addicted To Raw Cock! Mina Kitano

  • mina kitano censoredcreampiebig titsJUFEfitchJUFE-334JUFE334jufe00334
    • 2021-10-02
    139 min

    [PKPD-165]An 18-Year-Old Who Is OK With A Creampie During Compensated Dating. A Girl Who Is A Refined Gal From A School For Young Ladies. Reona Tomiyasu

  • takehiro tomiyasu censoredcreampieschoolgirlPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-165PKPD165pkpd00165
    • 2021-10-14
    59 min

    FCP-047 [Distribution Only] Put Out All! Cum Swallowing Vacuum Blow ＃ 1

  • amateur censoredamateurslutfcpfcp-047fcp047fcp-047
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-12
    57 min

    230OREC-939 Lala (Lara Kudo)

  • amateur censoredcreampieuniformorecorec-939orec939230orec-939
    • 2021-11-20
    240 min

    [MDBK-210]50 Of The Cutest And Most Adorable Baby Faces! Super Best! You Can"t Imagine How Erotic They Are From Their Cute Faces, And You"ll Be Hooked!

  • inaba scooping censoredcreampiecosplayMDBKbazookak taroMDBK-210MDBK210mdbk00210
    • 2021-12-06
    55 min

    328HMDN-433 [Celebration! !! First Anal] Former Weather Sister Her Cock Addiction Nasty Wife Reappears W Cock 2 Holes Inserting A Twisting Extra Fine Body And Fainting Continuous Acme. Vaginal Wall Gorigori Limit Breakthrough 2 Hole Creampie Acme Hel

  • amateur censoredanalcreampiehmdnhmdn-433hmdn433328hmdn-433
    • 2021-12-18
    135 min

    [GVH-332]Double Big Tits Sluts, Nene Tanaka / Miki Shiraishi

  • nene tanaka miki shiraishi censoredslutbdsmGVHglory questusubashi suiGVH-332GVH332gvh00332
    • 2021-12-23
    124 min

    [FSDSS-340]The Convenience Store Boss No One Likes Caught Right in the Middle of a Circle Jerk...G*******ged by All the Part Time Employees Until She Came Hard.

  • honda peach censoredsingle workFSDSSfalenoflagmanfaleno starFSDSS-340FSDSS3401fsdss00340
    • 2021-12-30
    210 min

    [VOV-072]Collection Of The Hottest Sluts! Sex Orgy Party Vol 7 "Can You Introduce Us To One Of Your Friends Who"s Even Sluttier Than You？"

  • censoredVOVit s thursday everyone gatheredthe orgy will begin on thursdayVOV-072VOV072h-1350vov00072
    • 2022-01-06
    109 min

    [AARM-050]Lap Up Her Nipples And Squeeze Your Cock With Her Tight Ass While She Swoons - Edged Until She Lets You Blow Your Load On Her Thighs

  • akari shinmura erika sasanami censoredAARMaroma kikakukadowaki shigeoaromaAARM-050AARM050aarm00050
    • 2022-01-07
    206 min

    [HUNTB-178]Touching Is Not Allowed With The Girl At The Men"s Massage Parlor, But My Disheartening Rejection Ends Up Giving Me A Serious Hard-on! Cumming Is Not Allowed With The Beautiful Girl Working At The Massage Parlor, And She Won"t Let

  • censoredcreampieuniformHUNTBhunterkawajirihhh groupHUNTB-178HUNTB178huntb00178
    • 2022-01-14
    41 min

    FC2PPV 2592156 [Personal Shooting / Creampie] Slut Wife Who Can Not Suppress Libido The Intensity Of The Waist Grind Was Alive And Well …

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored