jav gonzo creampie javcensored over hours




FC2AUKGSTARSSPRDSQTEATIDADNVEMAFSDSSONEZSSISAVSAAWDWANZKSBJHNDAUKGAUKSHMNWAAADTT

2020-09-24
67 min

FC2PPV 1512196 [Complete amateur 88] Marin 20 years old Part 2, F cup beautiful girl in bondage raw vaginal cum shot at SM hotel 2 barrage!

  • amateur uncensoredfc2
    • 2020-10-01
    130 min

    [JRZD-995]First Time Filming My Affair - Hiroko Mori

  • hiroko mouri censoredcreampiemature womanJRZDcenter villageminatoyajurakuJRZD-995JRZD995h-086jrzd00995
    • 2020-10-03
    189 min

    [HUNTA-862]My Neighbor Is A Horny Young Wife Who Is Hunting For Cocks, And I Fell For Her Trap And Her Lures Of Temptation, And Now She's Fucking My Brains Out! And Now That This Young Wife Is Massively Detonating All Of The Pent-Up Lust She'

  • censoredcreampieHUNTAhunterkoichi davidsonhhh groupHUNTA-862HUNTA862hunta00862
    • 2020-10-06
    89 min

    FC2PPV 1524949 ★ Limited time 1200pt ☆ Carefully selected! Cute ♥ Spogal ♥ Small breasts ♥ Sensitive BODY ♥ Rin-chan BEST Gonzo video release ♥ [Personal shooting]

  • amateur uncensoredfc2
    • 2020-10-12
    140 min

    [GONE-017]Cheers to Cock! At A Happening Hostess Bar With A Super-Pervert Mama-San. Welcome To Sex Beast Yuri Sasahara's Bar!

  • yuri sasahara censoredcreampiebig titsGONEmercurybirdman teppeierotic white sisterGONE-017GONE017h-1133gone00017
    • 2020-10-17
    118 min

    [PPPD-879]Titty Sensitivity Development Clinic Honoka Tsujii

  • tsujii honoka censoredbig titssquirtingPPPDoppaiPPPD-879PPPD879pppd00879
    • 2020-10-21
    49 min

    Caribbeancom 102120-001 Office Lovers: Punish And Treat By Female Boss And Male Boss Nanako Asahina, Runa

  • nanako asahina uncensoredcreampiecaribbeancom
    • 2020-10-21
    41 min

    330PER-324 Mitsuha

  • amateur censoredamateurperper-324per324330per-324
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-25
    121 min

    [ANX-128]The Art of Control Seminar LIVE - Performer: Yurika Aoi, Subject: Yurina Aizawa

  • yurika yurina aizawa censoredbig titsANXsaimin kenkyuusho bekkansaimin rei onna saimin kenkyuusho bekkanANX-128ANX128anx00128
    • 2020-11-01
    153 min

    [GOJU-172]An Older Woman From The Neighborhood, First Time Shots - Akiko (44)

  • censoredcreampieamateurGOJUfifty somethingGOJU-172GOJU172h-1165goju00172
    • 2020-11-21
    55 min

    FC2PPV 1577612 No33 Home Shooting I took a tall busty beauty to my home for the first time in a long time and took a secret shot.

  • amateur uncensoredfc2
    • 2020-11-29
    240 min

    [SOAV-071]A Married Woman's Faithless Heart Best Collection 4

  • kanako maeda yui no hikari censoredbig titsSOAVhitozuma engokai emmanuelleihyo kairoiSOAV-071SOAV071soav00071
    • 2020-12-05
    185 min

    [PRED-271]Creampie Hot Spring Sex With Your Lover (Aika) - Adultery While Your Wife Is Away On A Business Trip Aika Yamagishi

  • aika yamagishi censoredcreampiesingle workPREDpremiumnao masakielegancePRED-271PRED271pred00271
    • 2020-12-08
    41 min

    C0930 ki201208 Keiko Iijima 48years old

  • amateur uncensoredc0930
    • 2020-12-12
    120 min

    [EBOD-789]J-Cup Extra Thick Delivery Super Aggressive Type Slutty Girl Hunts Men With Extremely Slutty Outfits Chitose Yuki

  • chitose in the evening censoredcreampieslutEBODe bodyichigoharaEBOD-789EBOD789ebod00789
    • 2020-12-17
    167 min

    [MVSD-449]Shy About Her Cleavage - Busty Babe Insecure About Her Huge Tits Has Them Rubbed And Squeezed To An Intense Squirting Orgasm! Tomoko Kamisaka

  • tomoko kamisaka censoredbig titssquirtingMVSDm s video groupMVSD-449MVSD449mvsd00449
    • 2020-12-20
    146 min

    [HND-931]I Couldn't Meet With My Lady Boss So She Was Breaking In My Ass Remotely And We Conducted Mutual Masturbation For 30 Straight Days, And After That, We Released Our Pent-Up Lust With Creampie Sex. Yui Hatano

  • yui hatano censoredcreampieslutHNDhon nakajo asagiriHND-931HND931hnd00931
    • 2020-12-27
    78 min

    H4610 ki210102 Gold Pack 20years old

  • amateur uncensoredh4610
    • 2021-01-10
    109 min

    [APNS-222]Nailed By Nasty Older Guys Until She Succumbs To Pleasure... Erika Oka

  • hill erina censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-222APNS222apns00222
    • 2021-01-15
    60 min

    383REIW-022 Hotaru

  • amateur censoredbig titsmarried womanreiwreiw-022reiw022383reiw-022
    • 2021-01-16
    204 min

    [HUNTA-935]These Elder Sister Types Who Work At This Cafe Are Simply Erotic! I'm The Only Male Stuff Member And I'm Super Popular Here, So This Is The Absolute Greatest Workplace Ever!

  • censoredcreampieHUNTAhuntermorikihhh groupHUNTA-935HUNTA935hunta00935
    • 2021-01-27
    57 min

    230OREC-682 Konowa

  • amateur censoredcreampiebig titsorecorec-682orec682orec-682
    • 2021-02-05
    189 min

    [PLY-002]I'm So Embarrassed! A Reluctant Car Sex Documentary Himari Kinoshita/Nana Yaotome

  • nana yaotome himari kinoshita himari hanazawa censoredPLYplay entertainmentkaji shun wareplayPLY-002PLY002h-1557ply00002
    • 2021-02-18
    57 min

    [oretd-843]NARUMI

  • amateur censoredcreampieuniformoretdoretd-843oretd843oretd-843
    • 2021-02-24
    73 min

    FC2PPV 1700461 [First time limited 1980] I cup loli huge breasts beautiful wife ❤️ Live-action erotic cartoon state with anime voice ❤️ First nipple orgasm continuous Ikase ❤️ Pile up a meat stick for the first time in half a year with a big butt Cum

  • amateur uncensoredfc2
    • 2021-02-26
    128 min

    [SQTE-361]この子ヤバイ！！無邪気な顔してえっちに夢中 中城葵

  • nakagusuku censoredcreampieblowjobSQTEs cuteSQTE-361SQTE361sqte00361
    • 2021-02-28
    107 min

    [VENX-011]New Exclusive Actress! - Do You Get Excited By Older Women's Panties？ A Stepmom Uses Her Panties To Seduce Her Stepson And D***k Every Drop Of His Cum! - Minami Nagata

  • minami nagata censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-011VENX011venx00011
    • 2021-03-02
    63 min

    SIRO-4442 [First shot] [Foolery of sticky skin JD] [Signboard girl of general store] An active female college student with an appearance reminiscent of a favorable announcer. Contrary to her neat appearance .. AV application on the net → AV experienc

  • amateur censoredamateursirosiro-4442siro4442siro-4442
    • 2021-03-04
    184 min

    [SHIND-003]A Relentless Pervert Rides The Maso Train Home Invasion Record #5 6

  • censoredamateurSHINDshinkirousuzuki o maSHIND-003SHIND003h-1560shind00003
    • 2021-03-11
    96 min

    [FUGA-047]Steamy Unforgettable Sex With My Mom's Friend Satomi Sometani

  • satomi someya censoredcreampiemature womanFUGAcenter villageminami daichirakuen center villageFUGA-047FUGA047h-086fuga00047
    • 2021-03-12
    121 min

    [SUPA-573]Skipping Out On School To Go To A Hotel - ASUKA

  • censoredschoolgirlamateurSUPAskyu shirotokaoruSUPA-573SUPA573h-244supa00573
    • 2021-03-13
    62 min

    SIRO-4456 [First shot] [Beautiful receptionist with a gap] [With sincere service ..] Takamine’s flower standing at the reception is panting indecently and she feels too much and she begs for ejaculation with teary eyes .. On the net AV applicati

  • amateur censoredamateursirosiro-4456siro4456siro-4456
    • 2021-03-15
    172 min

    [PTYH-003]Cram School S*****t Face Sitting

  • censoredcreampieamateurPTYHpetersPTYH-003PTYH003h-021ptyh00003
    • 2021-03-16
    60 min

    300NTK-536 [10 head and body brown half beauty! !! 3 Squeezing SEX] Ichacola’s best older killer’s finest BODY half beauty! !! Boyfriend attacking with rich Echiechi service Gachi erection Ji ○ port rolls up! !! A super model style that loo

  • amateur censoredcreampieamateurntkntk-536ntk536300ntk-536
    • 2021-03-27
    56 min

    230OREX-216 Ichika-chan

  • amateur censoredcreampieuniformorexorex-216orex216230orex-216
    • 2021-04-02
    187 min

    [BBAN-321]The School For Young Ladies The Shameful Club Lesbian Series - S********ls Who Cum With Joy For Strap-On Deep Throat Deep Throat Breaking In Training - Akane Shiki June Lovejoy

  • akane shiki june lovejoy censoredlesbiandeepthroatBBANbibianBBAN-321BBAN321bban00321
    • 2021-04-02
    168 min

    [JBD-266]A Human Experiment Battle Of Hellish Lust This Test Subject Was Brought To Her Knees Through Shameful 3-Hole Pleasures Rui Hizuki

  • rui hizuki censoredsingle workJBDattackersusubashisuijabakuJBD-266JBD266jbd00266
    • 2021-04-06
    35 min

    FC2PPV 1757492 Up to 10 [Individual] A slender young wife who can take over her husband’s debt. Ruthless vaginal cum shot in the raw vagina that is raped by an ugly man and hates

  • amateur uncensoredfc2
    • 2021-05-13
    23 min

    FC2PPV 1816086 * Limited to 200 pieces 980pt [4K HDR] [Blowjob Friend Series] [Standing Nio → Polishing your dick → Ejaculation in the mouth] It usually licks for about 3 hours, but that’s boring, isn’t it？ Short version 2nd [Blow specializ

  • amateur uncensoredfc2
    • 2021-05-14
    155 min

    [MVSD-466]The Forbidden, Abnormal, School Field Trip I Could Never Forget The Creampie Sex I Had With My S*****t ... This Perverted Maso Female Teacher Used Her Own Money To Fund A Trip Of Shame Rimi Momono

  • rimi momono censoredcreampiebig titsMVSDm s video grouptrendy yamaguchiMVSD-466MVSD466mvsd00466
    • 2021-05-18
    63 min

    FC2PPV 1824407 A figure that should not be seen by women with gorgeous occupations. First shot SEX with vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-05-22
    246 min

    [NASH-513]Hot And Steamy Close Up Sex Opening Up Their Legs In The Middle Of The Day To Get Mounted! Beautiful Mature Women Have Their Cervixes Pounded Before They're Filled With Cum Best 4 Hours

  • censoredcreampiebig titsNASHnadeshikoNASH-513NASH513nash00513
    • 2021-06-04
    116 min

    [JBD-268]Miserable Young Wife Chiharu Miyasawa

  • chiharu miyazawa censoredsingle workJBDattackershana kanojabakuJBD-268JBD268jbd00268
    • 2021-06-11
    120 min

    [MIAA-453]I Am The Only Man In The Dorm, "Might I Get Fucked By Women..." And As I thought, My Balls Were Squeezed Until Every Last Drop Of My Cum Came Out. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampieblowjobMIAAmoodyzsapporo taroeveryone s porn starMIAA-453MIAA453miaa00453
    • 2021-06-19
    158 min

    [CJOD-300]Goto Affair Travel: Big-Tits Celeb Wife And Rich Old Guy's Creampie Exchange Romance With Yu Shinoda

  • shinoda yu censoredcreampieslutCJODchijo heavenkanoa tojoCJOD-300CJOD300cjod00300
    • 2021-07-14
    126 min

    [SSIS-128]Mixed Body Fluids, Deep Sex - Completely Uncut Special - Konan Koyoi

  • koyoi konan censoredbig titssingle workSSISs1 no 1 stylemichiru arashiyamaSSIS-128SSIS128ssis00128
    • 2021-09-03
    120 min

    [ADN-345]The Chronicles Of Fucking My Asshole Boss"s Wife For 3 Days And Nights, Starring Kana Kusakabe

  • kana kusakabe censoredbig titssingle workADNattackerskitorune kawaguchiotona no dramaADN-345ADN345adn00345
    • 2021-09-23
    93 min

    [OKB-120]Suzu Ayano A Voluptuous Big Ass A Goddess In Bloomers From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy Hai

  • ayano suzuju censoredschoolgirlsingle workOKBoyaji no kosatsukami bloomersOKB-120OKB1201okb00120
    • 2021-10-01
    128 min

    [JUTA-123]4 Years Since Then... Reborn, Ryoko Tachibana 47 Years Old, Super Slender Hot Wife"s First Creampie Threesome

  • ryoko tachibana censoredcreampiemature womanJUTAjuku onna japan emmanuelletokugawa museijuku onna japanJUTA-123JUTA123juta00123
    • 2021-10-09
    58 min

    H0930 tk0043 Yukie Nishiaki 35years old

  • amateur uncensoredh0930
    • 2021-10-13
    240 min

    [270JGAHO-258]息子に求められる五十路母の卑猥な贅肉 吉岡照美 桜木かおる 中山みどり 福田和代 木戸雅江

  • amateur censoredmilfamateurjgahojgaho-258jgaho258270jgaho-258
    • 2021-10-24
    46 min

    404DHT-0326 Nori Good Slender Widow And Anal! Rika 48 Years Old

  • amateur censoredmarried womanamateurdhtdht-0326dht0326404dht-0326
    • 2021-11-11
    57 min

    FCP-052 [Delivery Only] I Love Subjectivity! !! Be Careful Too Much! !! No Waiting For Ejaculation With Amazing Rerorero Belochu Handjob! 4 (Sakura Tsukino, Saya Matsui, Rin Miyazaki)

  • amateur censoredamateurbeautiful girlfcpfcp-052fcp052fcp-052
    • 2021-11-20
    170 min

    [DGCEMD-086]Available Exclusively! Bonus Footage Included. Losing Body And Mind To Get Submissive For Me - Rina Takase - See Her Get Lewd And Submissive As A Pet For Me.

  • rina takase censoredbig titsmature womanDGCEMDceleb no tomoDGCEMD-086DGCEMD086dgcemd00086
    • 2021-11-26
    29 min

    FC2PPV 2467157 Prefectural General Course Tall Valley Club ② Uncle Gets Fucked To Meet A Long-Distance Boyfriend. * Limited To 100

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored