jav hours more javcensored beautiful girl schoolgirl




FC2PREDCHRVHODVSANMIAAVEMAHMNHUNTBMEYDIPXNACXNACRSQTEHDKAAWDDASDFSDSSMILKSTARSAVSA

2020-11-17
80 min

261ARA-464 [Active female college student] 21 years old [Mechakawa & legs] Sara-chan is here! The reason for her application to go to college is “I want to be a SEX student rather than studying …” I’m full of horny things! [Ch

  • amateur censoredamateuraraara-464ara464261ara-464
    • 2020-11-20
    77 min

    [OTIM-044](Streaming Exclusive) (Daydream POV) Ordinary And Nonchalant But With A Body I Want To Fuck Yukino Nagasawa

  • yukino nagasawa censoredcreampiebig titsOTIMprestigeonetimeOTIM-044OTIM044118otim00044
    • 2020-12-04
    81 min

    259LUXU-1351 Luxury TV 1335 A beautiful dancer who decided to appear on AV because she couldn’t be satisfied with her usual sex. It is tossed by a violent piston and disturbs her hair and is disturbed many times!

  • amateur censoredamateurluxuluxu-1351luxu1351259luxu-1351
    • 2020-12-06
    112 min

    [MGMQ-062]Nympho Nurse Domme Uses Men's Anal Holes At The Hospital Yuka Hirose

  • yuka hirose censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-062MGMQ062mgmq00062
    • 2021-01-25
    68 min

    IDJS-035 Shizuka

  • amateur censoredamateurbeautiful girlidjsidjs-035idjs035idjs-035
    • 2021-01-27
    63 min

    230OREC-687 Suzuka

  • amateur censoredcreampieamateurorecorec-687orec687orec-687
    • 2021-01-31
    47 min

    493PKPD-091 [Leaked] Cosplay JD and 3P seeding FU ○ K picked up in Shibuya on Halloween

  • amateur censoredcreampieamateurpkpdpkpd-091pkpd091493pkpd-091
    • 2021-02-12
    162 min

    [DASD-812]Beautiful Girls With Big Cocks Cum Hard - Lost Rare Treasures

  • mitani akari kato momoka censoredsquirtingbeautiful girlDASDdasnao masakiDASD-812DASD812dasd00812
    • 2021-02-12
    240 min

    [MGT-135]Picking Up Girls In The Street! Vol. 101 Halloween Amateur Pick Ups 2020 In Shibuya

  • censoredcreampiebig titsMGTprestigemegatraMGT-135MGT135118mgt00135
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-25
    93 min

    [OKS-106]Wet And Shiny, Perfectly Fitting Godly Swimsuit: Minano Sena Is Enjoying Her Cute Girls' School Swimsuit! This AV Starts With A Voyeur Video Of Big And Small Breasts And Moves On To A Number Of Fetish CLose-ups, Such As Shaved Pussies, H

  • minano sena censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-106OKS1061oks00106
    • 2021-02-27
    150 min

    [FONE-135](Private Shots Solicited) Shy Girl In Glasses With A Young Face And Colossal Tits. Horny Slut Hasn't Had Sex In 5 Years Over A Complex About Her Massive Knockers And Is Desperate To Fuck - Gallons Of Squirting As Her Sensitive Body Lose

  • censoredcreampiebig titsFONEfirst starganto kanburoplus first starFONE-135FONE135h-491fone00135
    • 2021-02-27
    178 min

    [MIDE-888]Kiss Me Right Now: Twirl Your Tongue, Deep, Thick Kisses And Close-up Intercourse - Nana Yagi

  • nana yagi censoredbeautiful girlsingle workMIDEmoodyzusa pyonmoodyz divaMIDE-888MIDE888mide00888
    • 2021-03-19
    129 min

    [CMV-152]Enema On The Train Female S*****t Devotes Her Beautiful Asshole To Her Bookstore Owner Step Father Mika Takatsuki

  • mika takatsuki censoredbdsmsingle workCMVcinemagicmarukatsuvixenCMV-152CMV152cmv00152
    • 2021-03-27
    58 min

    476MLA-034 [Daddy activity infiltration, Echika-chan edition] Blow face in love ☆ Mekkawa 19 years old Apparel clerk is a sensitive slender body with extremely high face level! Change into obscene lingerie and have convulsions guck gaku big cum! Two

  • amateur censoredcreampieamateurmlamla-034mla034476mla-034
    • 2021-03-27
    239 min

    [MCSR-433]Slutty Cougars Widows Get Fucked In Front Of Portraits Of Their Dead Husbands 8 Women 4 Hours

  • censoredcreampiemature womanMCSRbig morkalguo masumascottMCSR-433MCSR43357mcsr00433
    • 2021-04-01
    57 min

    FCP-008 [Delivery only] Absolutely subjective! !! Sperm is almost exhausted! Super feeling good! !! Nipple Licking Handjob ＃ 2

  • amateur censoredamateurfcpfcp-008fcp008fcp-008
    • 2021-04-08
    208 min

    [PIYO-111]男っぽいことを悩んで女らしくなりたいと教師に相談したら、未成熟な身体を強●的に開発されてメスイキしまくったボーイッシュ女子校生

  • censoredPIYOchickclown fieldwolfPIYO-111PIYO1111piyo00111
    • 2021-04-09
    146 min

    [IPX-635]I Can't Live Without Sex Anymore... 159 Incredible Orgasms, 2048 Pussy Spasms, 3211 Thrusts, Squirting With Pleasure, Her Erotic Awakening Miu Shiromine

  • shiramine miu censoredsquirtingsingle workIPXidea pocketdragon nishikawadishIPX-635IPX635ipx00635
    • 2021-04-30
    257 min

    [HEZ-275]Street Pick Up Of First Class Hot Celeb Mature Chick w/ Creampie Finish 29

  • censoredcreampiebig titsHEZhot entertainmentstudio zerohot premium rose docuHEZ-275HEZ27559hez00275
    • 2021-05-01
    120 min

    [NACR-418]I Was Domesticated By My Father-In-Law Natsu Tojo

  • natsu tojo censoredcreampiesquirtingNACRplanet plusbito sakurananakuruNACR-418NACR418h-237nacr00418
    • 2021-05-08
    127 min

    [BAHP-076]When She Got Her Voluptuous, 100cm Big Ass Groped And Fondled During An Oiled-Up Sensual Massage, Her Pussy Got Dripping Wet And Ready, And Then She Experienced A Mind-Blowing Orgasm, And That's The Story Of This Teeny Tiny JD Hina Kawa

  • haruna kawai censoredsingle workBAHPbaltandaibutsu yoshidahoppinBAHP-076BAHP076bahp00076
    • 2021-06-19
    118 min

    [JUL-610]Ann Komatsu (Our Major Exclusive Actress) x A Super Sure Thing (The "Shared Room" Series)!! I Was On A Business Trip, And To My Surprise, I Was Booked Into A Shared Room At The Business Hotel With My Favorite Lady Boss

  • anzu komatsu censoredmature womansingle workJULmadonnamametaro mamezawaJUL-610JUL610jul00610
    • 2021-06-19
    120 min

    [DASD-878]Creampie Waitress Is A Married Woman. Pay Your Bill With Your Body! Celia Aitsuki

  • aitsuki celia censoredcreampiesingle workDASDdasDASD-878DASD878dasd00878
    • 2021-06-29
    101 min

    [NUBI-052]Illicit Underground Idol Business For Funk Love Members Only Extreme Underground Idol Meet And Greet Has The Girls Letting Fans Grope Them And Look At Their Panties!

  • censoredamateurNUBIkalimantannubiaNUBI-052NUBI052h-1112nubi00052
    • 2021-07-14
    57 min

    510ELLO-012 Concafe Nampa Mikuru chan

  • amateur censoredamateurelloello-012ello012510ello-012
    • 2021-08-10
    126 min

    [KTRA-320]A Creampie Inside The Shaved Pussy Of My Slender Stepsister: Stepsibling Adultery. Misara Kaga.

  • kagami sara censoredcreampiesisterKTRAke toraibuk tribeKTRA-320KTRA320h-094ktra00320
    • 2021-08-12
    68 min

    FC2PPV 1997997 [Complete Amateur 116] Ayana Vs Noah, Complete Appearance, 3p With Two Popular Beautiful Girls And Maid Clothes! Both Of Them Have A Vaginal Cum Shot! !!

  • amateur uncensoredfc2
    • 2021-08-13
    230 min

    [HUNTB-084]I End Up Sharing A Room With My Boss! The Aircon Broke Down And We Were Both Sweating Too Much

  • censoredcreampieblowjobHUNTBhunterkonjac kanohhh groupHUNTB-084HUNTB084huntb00084
    • 2021-08-26
    123 min

    [IENF-160]No Orgasm Challenge Against A Hung Male Porn Star!？ College Girl Creampie Quickie Contest! We Told These Adorable Amateurs That If They Withstood Our Studs" Sex Skills They"d Win Big, But If They Don"t They"ll Get Their Puss

  • scooping aina hayashi censoredcreampieamateurIENFie nergytaiga kosakaiienfIENF-160IENF1601ienf00160
    • 2021-09-10
    190 min

    [UMD-796]Her Husband Was A****p Right Next To Her, But On The Other Side Of That Curtain, She Was Getting Her Slick And Slippery Titties Fondled And Fucked!! This Horny Madam Wanted A Filthy Oil Massage Therapist To Stick His Rock Hard Cock Inside He

  • maki kyoko ayano kato censoredbig titssquirtingUMDleotabu oosakiUMD-796UMD796125umd00796
    • 2021-09-24
    111 min

    [VENX-076]My Hot Stepmom Is Left At Home When Dad Is Away On Business Trip. Now She Gets Non-stop Creampie Action. Ruka Aise

  • ruka aise censoredcreampiemature womanVENXvenuspe taincest vi nasuVENX-076VENX076venx00076
    • 2021-09-28
    42 min

    H0930 ki210928 Emi Kinoshita 48years old

  • amateur uncensoredh0930
    • 2021-09-30
    16 min

    Caribbeancom 093021-001 Pussy Encyclopedia: Chihiro

  • chihiro uncensoredcaribbeancom
    • 2021-10-01
    160 min

    [CAWD-288]A Sweetly Sadistic Beautiful Y********l In Uniform Who Loves B.B. Boys Incessantly And Will Shut Down Your Reasonable Mind Through Nipple Teasing Yumeru Kotoishi

  • yume kotoishi censoreduniformslutCAWDkawaiikc takedaCAWD-288CAWD288cawd00288
    • 2021-10-09
    108 min

    [NSFS-031]The Boss and His Wife Underling 17. A Wife Gives Into Lustful Desires At The Home Of Her Husband"s Parents. Mayuka Kitagawa

  • mayuka kitagawa censoredmature womansingle workNSFSnagae stylenagaeNSFS-031NSFS031nsfs00031
    • 2021-10-28
    60 min

    Pacopacomama 102821_551 Wives Drink Cum 121 Yuriko Hosaka

  • amateur uncensoredpacopacomama
    • 2021-10-28
    129 min

    [CHERD-077]"Not Keen on First Bare Back Being With an Older Lady？" Cherry Boy"s Perfect First Time Sex With Mature Married Woman. Miyu Tsubakihara

  • miyu tsubakihara censoredcreampiemarried womanCHERDcenter villageshibuyahanazono center villageCHERD-077CHERD077h-086cherd00077
    • 2021-10-29
    131 min

    [VOD-005]Real Celebrity Kyoko Machimura Documentary No. 2. Deep French Kissing With A Total Coverage Fuck That Gets So Wet And Wild She Practically Forgets She"s On Camera.

  • kyoko machimura censoredcreampiemature womanVODvenuspe tareality venusVOD-005VOD005vod00005
    • 2021-10-29
    139 min

    [MMND-202]"Excessive Filming" Nanami Ogura A 19-Year Old Innocent Babe With F-Cup Tits And A Voluptuous Body A Sakamichi-Style, Pure And Beautiful Girl

  • nanami ogura censoredbeautiful girlsingle workMMNDmimaniwasawa yukiMMND-202MMND202mmnd00202
    • 2021-11-20
    137 min

    [GMEM-049]This Plump Masochistic Wife With A Big Ass Awoke To Her Lewdness And Turned Into A Sex Doll

  • censoredbukkakeGMEMavs collector sbuddha davscollector s goldGMEM-049GMEM049gmem00049
    • 2021-11-20
    140 min

    [BOKD-238]Prostate Stimulation And Cum Leaking Out Like Tokoroten SEX - Tsumugi Kashii

  • kashii tsumugi censoredcreampiesingle workBOKDwe re she malesdorikawaBOKD-238BOKD238bokd00238
    • 2021-11-29
    52 min

    FC2PPV 2471454 Limited Number! !! [Uncensored] Twilight Date On The Beach At Sunset With The Receptionist Of The Beauty Clinic … Obscene In A Closed Room With A Viewer And The Last Vaginal Cum Shot On An Elegant Body! !! This Is Her Last Work &#

  • amateur uncensoredfc2
    • 2021-12-02
    55 min

    FC2PPV 2483055 The Day When I Dated The Cutest Junior And Was Flirting Sweetly + The Day When I Teamed Up With The Disappeared Junior And Took A Super Cute Child In The Car

  • amateur uncensoredfc2
    • 2021-12-11
    132 min

    [FCDC-139]The Secretary With The Big Breasts And Dirty Nipples Is A Slut Who Seduces Her Employees.

  • hazuki shuri censoredbig titsslutFCDCweekenderFCDC-139FCDC139fcdc00139
    • 2021-12-23
    104 min

    [SPRD-1501]Prim & Proper Married Neighborhood Slut Suzuka Aoyama

  • ryoka aoyama censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1501SPRD150118sprd01501
    • 2021-12-24
    156 min

    [CRDD-016]I Put Out An Ad For A Nude Model To Do A Private Photo Session, But Then This Super Cute Model Named Chloe Showed Up, Looking For Sex!？ I Had Raw Creampie Sex With A C*ck-Loving Blonde Beautiful Girl

  • censoredcreampiebig titsCRDDcrazy walkermanjiroCRDD-016CRDD016crdd00016
    • 2022-01-01
    150 min

    [KTB-058]Welcome To This Rental Office, Where You Can Spend 3 Days And 2 Nights With A Married Woman Secretary Enjoy Shameful Plays, Bukkake, Impregnation, And Seductive Sales Talk, All Captured On Video Record - Yuri, A Wife-For-Rent - Yuri Sasahara

  • yuri sasahara censoredcreampiesingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-058KTB058ktb00058
    • 2022-01-02
    65 min

    SIRO-4751 [First Shot] [Soft Beautiful Breasts] [Massive Squirting] A Nursing Student Whose Cowgirl Stakeout Is Too Erotic Appears. The Body Is Flushed By The Advance Of The Penis, And It Cums Continuously With A Fluffy Face .. Av Application On The

  • amateur censoredsquirtingamateursirosiro-4751siro4751siro-4751
    • 2022-01-07
    62 min

    498DDH-060 A Gal Who Wants To Be Faithful To His Desire To Call Himself [Hobby: Nipple Groping]! Aiming At Ji ● Po And Rushing Forward "Don’t Be Afraid W" Sperm Cum Swallowing Happily And Deliciously → Mitsubayashi Ma ● When You Divide I

  • amateur censoredamateurddhddh-060ddh060498ddh-060
    • 2022-01-08
    135 min

    [BAHP-099]It Was My First Time Trying To Be Dominant In Bed, But I Ended Up Getting Devoured By Submissive Men Starring Koa Amane

  • amane romance censoredbig titsslutBAHPbaltanyuki moguerahoppinBAHP-099BAHP099bahp00099
    • 2022-01-13
    142 min

    [SPRD-1502]The Surrogate Mother. Nao Nakano.

  • nanao nakano censoredcreampiemature womanSPRDtakara eizosanpei suminekoaleddinSPRD-1502SPRD150218sprd01502
    • 2022-01-15
    170 min

    [ANKB-006]Beastly FUCK In A Mixed Bathing Hot Spring! A Slender Girl With A Lewd Pussy And Huge Tits

  • censoredcreampiebig titsANKBlove ma ko mousozokutakechanANKB-006ANKB006ankb00006
    • 2022-01-26
    59 min

    FC2PPV 2622316 Reunion With A Convenience Store Clerk [She Is Rumored To Be Yamato Nadeshiko] Honeymoon With An Elderly Person, Blowjob, Fucking, And Three-Point Training Start At A Hotel In The Daytime

  • amateur uncensoredfc2
    • 2022-02-18
    237 min

    [REXD-402]You Did Nothing Wrong, But... Made To Fuck Live On Camera Club "Hey, Do You Remember Me？"

  • censoredcreampieschoolgirlREXDredmanji groupREXD-402REXD402rexd00402
    • 2022-02-19
    143 min

    [DAYA-018]The Older Sister, A Gal And Model, Leads Middle-Aged Guys By Their Noses. Rika, 22 Years Old. Rika Tsubaki

  • tsubaki rika censoredbig titsblowjobDAYAdigital arkaida yumenodigital ark digital arkDAYA-018DAYA018daya00018



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored