jav javcensored handjob high vision censored




FC2SSISPPPDHMNAMBISDABSQTECJODDASDAUKGSTARSAUKGABWJUFESHKDMEYDCAWDSSNIMIDVMILKMIDE

2020-12-31
130 min

[SHKD-922]The G*******g Plan The New Employee Mahiro Ichiki

  • mahiro ichiki censoredsingle workSHKDattackerssharkSHKD-922SHKD922shkd00922
    • 2021-01-09
    120 min

    [MIDE-873]Her Lust Is Off The Charts! She Hasn't Gotten Laid In 30 Days And Now She's Desperate To Get Fucked - Raging Horny Slut At A Hot Spring Ibuki Aoi

  • aoi ibuki censoredbig titssingle workMIDEmoodyzmichiru arashiyamamoodyz divaMIDE-873MIDE873mide00873
    • 2021-01-17
    110 min

    [NYKD-110]First Time Shots At 60 Something - Tsubasa Fukayuki

  • miyuki tsubasa censoredmature womansingle workNYKDrubymaterukazu umiyamayokihiNYKD-110NYKD110nykd00110
    • 2021-01-24
    147 min

    [APKH-161]Wow! Check Out Her Ultra Slim Body And Those Super Beautiful Big Tits! "My Body Is Hungering For Cock..." She's Like A Whore When It Comes To Cock, And Now This Sensual Y********l In Uniform Is Cumming Like Crazy During A Furiou

  • karen otoha censoredcreampiebig titsAPKHaurora project annexhaurora project anexAPKH-161APKH161apkh00161
    • 2021-01-27
    62 min

    230OREC-681 Megu

  • amateur censoredcreampiebig titsorecorec-681orec681orec-681
    • 2021-01-31
    103 min

    [XVSR-574]I Can't Take It Anymore! Seduced Into Cheating Creampie Sex Under The Heater Blanket Kotone Suzumiya

  • kotone suzumiya censoredcreampieslutXVSRmax ak c takedacalenXVSR-574XVSR574xvsr00574
    • 2021-02-06
    116 min

    [ADN-296]I Work Overtime Every Day With My Lovely Female Boss. Yu Shinoda

  • shinoda yu censoredcreampiebig titsADNattackersnaotootona no dramaADN-296ADN296adn00296
    • 2021-02-06
    170 min

    [JUL-454]Exclusive - Iori Nanase's Shocking Madonna Debut! Totally Absorbed In French Kisses And Three Full Fucks

  • iori nanase censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-454JUL454jul00454
    • 2021-02-11
    66 min

    [orec-688]まこ

  • amateur censoredcreampiebig titsorecorec-688orec688orec-688
    • 2021-02-12
    118 min

    [IPX-616]His S*****t's Wet Uniform Looks Too Enticing... On Rainy Days, She's Definitely Going To Get Ravished Yume Nishimiya

  • yume nishinomiya censoredsquirtingschoolgirlIPXidea pocketamazing meatdishIPX-616IPX616ipx00616
    • 2021-02-12
    115 min

    [PARATHD-3113]Don't Laugh! Undressing Ogiri: Complete Edition

  • saki mizumi pretty censoredPARATHDparadise tvPARATHD-3113PARATHD3113parathd03113
    • 2021-03-11
    158 min

    [MIST-329]Ovulation Day Special! This Delivery Maid Is Ready To Be Impregnated Erina Oka

  • hill erina censoredcosplayMISTmr michirusaitaMIST-329MIST3291mist00329
    • 2021-03-12
    120 min

    [XRW-987]A Woman Who Loves Licking Dicks - Akari Niimura

  • akari shinmura censoredblowjobslutXRWreal worksani nakamurareal real worksXRW-987XRW987172xrw00987
    • 2021-03-12
    118 min

    [DHT-242]Porno Return Second Debut! Makoto Hoshimura 32 Years Old

  • makoto hoshimura censoredmature womanDHThot entertainmentblade take leeDHT-242DHT24259dht00242
    • 2021-03-26
    240 min

    [ENKI-035]Gratitude For Raw Dicks! This Perverted Elder Sister Type Will Provide You With Horny Hospitality And Will Fuck As Soon As You Met Her Yui She's Good To Go And Is Ready For Plenty Of Raw Fucking And Semen Pumped Into Her Pussy

  • censoredcreampieENKIpoisonous banquetENKI-035ENKI035h-1406enki00035
    • 2021-04-16
    38 min

    FC2PPV 1772933 Realistic GoPro video + iPhone high quality Ver ❤️ Hirosue ● Call the legendary "Pukuman" Kanon on holidays and take a daytime affair Icha Koi Gonzo ❤️ Many purchase benefits

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-30
    141 min

    [BNST-027]Freaky Families: "Hey Big Bro! Do You Love Me？" While Our Parents Were Away For Three Days My Twin Stepsisters Seduced Me With Their Big Tits

  • first love maina miku censoredbig titssisterBNSTteacher delusion groupkamagramBNST-027BNST027bnst00027
    • 2021-05-07
    160 min

    [SUN-014]Horny Housewives (Bunny) - She Can't Survive Without Cum - Exhibitionist Seduces Dicks At A Sex Shop And Swinger's Club

  • kazama yumi censoredbig titsmature womanSUNsunbacon tanakaSUN-014SUN01413sun00014
    • 2021-06-14
    117 min

    503KOO-009 Hinako

  • amateur censoredamateurbeautiful girlkookoo-009koo009503koo-009
    • 2021-06-16
    226 min

    [HUNTB-040]After Missing The Last Train Home, My Co-Worker At My Part-Time Job Came Over For A Nightcap. 2 After Her Farewell Party, I Knew That I Wouldn't Be Seeing Her Anymore Starting Tomorrow, So I Could No Longer Help Myself, And Decided To

  • censoredHUNTBhunterspace nyanjirohhh groupHUNTB-040HUNTB040huntb00040
    • 2021-07-02
    38 min

    520SSK-014 Mio

  • amateur censoredcreampieamateursskssk-014ssk014520ssk-014
    • 2021-07-03
    110 min

    [ANB-191]I'm Obsessed With My Beautiful And Erotic Step Aunt's Gorgeous Big Tits And Super Sexy Body Yuki Inaba

  • yuki inaba censoredsquirtingmature womanANBrubysusumu yanokuchinobleANB-191ANB191anb00191
    • 2021-07-21
    37 min

    FC2PPV 1934313 Infiltrate A Secret Orgy ㉞ Perfect Hips ♥ Beautiful Ass Is Crowded With More Aggressive Ossans Than Usual! 5 Thick Sperms Dripping From The Nice Ass ♪ * High Quality Version & Review Benefits Included ★

  • amateur uncensoredfc2
    • 2021-07-26
    46 min

    IDJS-064 Maki

  • amateur censoredcreampieamateuridjsidjs-064idjs064idjs-064
    • 2021-08-26
    107 min

    [SPRD-1452]So Much Better Than My Husband... Chisato Shoda

  • shota chisato censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1452SPRD145218sprd01452
    • 2021-08-29
    107 min

    300NTK-630 [Large Squirting Erotic Gal & Mutsuri Beautiful Breasts JD! !! A Big Orgy Sp With A Dash Pick-Up For Two People At The Same Time! !! ] Do Lewd Beauty Gal & Ona Medium Sensitive Beautiful Breasts Jd Duo! !! Demonstrate The Erotic Po

  • jdjd censoredcreampiebig titsntkntk-630ntk630300ntk-630
    • 2021-08-31
    213 min

    [STARS-420]An SOD Star Transfer Anniversary Video An Obedient Creampie Hot Spring Vacation Konomi Yoshinaga

  • yoshinaga konomi censoredsoloworkSTARSsod createakai suiseisod starSTARS-420STARS420
    • 2021-09-01
    144 min

    [SS-153]Amateur Sailor Cosplay Creampie Sex (Revised) Beloved Sailor Uniform Creampie Raw Footage A Fuck You Summer Vacation When This 148cm-Tall Little Devil Is Arching Her Body In That S-Shape As She Cums, She Looks Like An Excessive Angel Of Sexua

  • shirakawa yuzu censoredcreampiesoloworkSSpuramuse ra fuku to kikan boushirouto only plumSS-153SS153
    • 2021-09-10
    119 min

    [ROE-008]"My Beloved Wife Becomes A Woman After S******g With Stepson..." Midlife Lewd Spouse Drama By MONROE!! Kyoko Ichikawa

  • kyoko ichikawa censoredbig titsmature womanROEmadonnasatsugu koyamamonroeROE-008ROE008roe00008
    • 2021-09-17
    119 min

    [MEYD-705]NTR At My Part-Time Job I Was Listening To A Horny Married Woman Complain About Her Life, And Then She Started Having Creampie Sex With Me, Every Single Day Ichika Seta

  • kazuhana seta censoredcreampiebig titsMEYDtameike goroinugami ryouMEYD-705MEYD705meyd00705
    • 2021-09-24
    157 min

    [ROYD-067]My C***dhood Friend Is A Beautiful Older Woman With F-Cup Titties, And Now That I"ve Paid My Subion Fees, I Can Insert My Dick Whenever I Want, As Much As I Want! As Long As I Pay The Monthly Fees, I Can Fuck Her Anytime, Anywhere, As M

  • mikako horiuchi censoredcreampieblowjobROYDroyalmorikihhh groupROYD-067ROYD067royd00067
    • 2021-09-30
    87 min

    435MFC-146 [2 In 2 Facial Cumshots 3P Gonzo] 2 Full Erection Meat Sticks Attack Mako Of Beautiful Big Tits H Cup Saffle! In The First 3P, Both The Upper Mouth And The Lower Mouth Are Filled With Cheeks And I Am Very Excited! Enchantedly In A Heavenly

  • amateur censoredcreampiebig titsmfcmfc-146mfc146435mfc-146
    • 2021-10-06
    480 min

    [RVG-143]Kanohana BEST vol. 1

  • kanna flower censoredslutRVGglory questRVG-143RVG143rvg00143
    • 2021-10-08
    79 min

    300NTK-643 [W Beauty Bitch Summit Decisive Battle! !! Slender Vs Boyne’s W Bitch Dream Competition Gangbang! !! ] Supreme Vs Ultimate! !! Dochashiko Smashing Orgy 4p! !! Slender Gals And Rocket Milk Gals Of Course W Bitches! !! Betting The Pride

  • amateur censoredcreampieamateurntkntk-643ntk643300ntk-643
    • 2021-11-04
    73 min

    [REBD-601]Minamo Hibiscus And Horizon MINAMO

  • minamo censoredsingle workREBDrebeccazack araiREBD-601REBD601h-346rebd00601
    • 2021-11-12
    60 min

    518ASGM-028 [Sleep Fucking / Intravaginal Ejaculation] Shibuya Ward White Panty Beautiful Girl Hidden Shooting (Metropolitan / Ordinary Course) Estimated F Cup

  • amateur censoredcreampiebig titsasgmasgm-028asgm028518asgm-028
    • 2021-11-25
    56 min

    OREX-329 Marina-chan (Marina Hiiragi)

  • amateur censoredcreampiebig titsorexorex-329orex329orex-329
    • 2021-11-26
    238 min

    [THTP-053]Record of a Female Teacher who Falls for Lesbian Pleasures

  • censoredamateurblowjobTHTPthree top publishingttpTHTP-053THTP053h-1237thtp00053
    • 2021-12-03
    141 min

    [HEYZO-2688]tong jenny waan Sex in Asia ＃Tong ＃Jenny ＃Waan

  • amateur uncensoredheyzo
    • 2021-12-10
    118 min

    [IPX-771]My Favorite Fiance"s Brother Is A Stubborn Stalker Who Used To Fuck Me Without My Permission Miu Shiramine

  • shiramine miu censoreddeepthroatsingle workIPXidea pocketzaku araidishIPX-771IPX771ipx00771
    • 2021-12-10
    92 min

    ZOCT-043 Renai-san (Amane Koa)

  • amateur censoredcreampieamateurzoctzoct-043zoct043zoct-043
    • 2021-12-11
    239 min

    [CADV-834]The Girl Of My Dreams, Nanami Matsumoto

  • nana matsumoto censoredcreampiesingle workCADVcrystal eizoucrystal exCADV-834CADV834cadv00834
    • 2021-12-14
    480 min

    [MUCH-143]Big Tits! Chubby Maniacs 3 10 Girls 8 Hours 2 Discs

  • anne kitajima kojima miwa censoredbig titsMUCHmothermuchimuchiMUCH-143MUCH143h-796much00143
    • 2021-12-17
    123 min

    [TPPN-214]Hikari Hii"s First Attempt, Uned, Unacted, Instinctive Real Intercourse, Sweaty Oni-pis And Her First Climax!

  • hikari hime censoredcreampiebig titsTPPNteppanTPPN-214TPPN214tppn00214
    • 2021-12-24
    36 min

    FC2PPV 2541323 [No] [Limited To 100 Pieces Off From 2980 To 1480pt!] Slender Body Beauty Like A Model! Even Though She Has A Baby Face, She Has Super Beautiful Legs And Super Beautiful Butt ♥ The Line From The Waist To The Butt Is Perfect! It Can Be

  • amateur uncensoredfc2
    • 2022-01-25
    77 min

    435MFCS-004 [Leaked] [Let A Beautiful Model Fall Asleep And Sperm Fertilization Of Another Person ♪] Reverse Nan Ntr Play Of A Man At An Izakaya! A Piston With A Rhythm Different From That Of Her Boyfriend … A Pant Voice That Gradually Grows 

  • amateur censoredcreampieamateurmfcsmfcs-004mfcs004435mfcs-004
    • 2022-01-28
    128 min

    [VOD-006]The Second Document Of A Real Amateur Wife, 100cm K-cups Glossy With Lustful Tongue Kisses And Sweat... First Continuous Creampie 3p Sex Warm Hibino

  • hibino wen censoredcreampiebig titsVODvenuskaniereality venusVOD-006VOD006vod00006
    • 2022-02-04
    150 min

    [IPX-806]- Unleashed - The Feeling Of The First Raw Creampie In Your Life Is Something Else Altogether. Going After Creampies!! Miu Shiramine

  • shiramine miu censoredcreampieblowjobIPXidea pocketkyoseidishIPX-806IPX806ipx00806
    • 2022-02-10
    145 min

    [DRPT-006]At This Beauty Salon, A Big Tits Girl Was Stripped Totally Nude Underneath That Cape, And She Became So Embarrassed That Her Entire Body Became A Sensual G-Spot Zone Marina Hiiragi

  • marina hiiragi censoredcreampiebig titsDRPTdenno rasputinlemonheart nakajimaDRPT-006DRPT0061drpt00006
    • 2022-02-11
    121 min

    [MIDV-049]Confident Female Boss And Her Cherry Boy Employee Share A Hotel Room On A Business Trip... After Deciding To Spend The Night With My Clumsy Employee, I Give Into His Amazing Dick And Get Non-stop Orgasms Till Morning. Mia Nanasawa

  • nanasawa mia censoredbeautiful girlsingle workMIDVmoodyzsapporo taromoodyz divaMIDV-049MIDV049midv00049
    • 2022-02-12
    125 min

    [BIJN-216]The Documentary A Basic Instinct-Baring Orgasmic Fuck Fest A Baby-Faced, Flesh Fantasy H-Cup Titty, Bushy-Bush Furiously Slutty Sexual Monster Mei Hosho

  • mei hosho censoredbig titssingle workBIJNbijin majo emmanuelleBIJN-216BIJN216bijn00216
    • 2022-02-12
    118 min

    [ZOCM-023]Ditzy Crybaby Is Secretly A Wild Slut... She Says She"s A 40" H-Cup Online And Her Uniform Fits Her Colossal Tits Way Too Well - Kinky Sex With A Barely Legal Beautiful Girl Riho Takahashi

  • riho takahashi censoredcreampiebig titsZOCMthrilling girls the daydream tribetodothrilling girlsZOCM-023ZOCM023zocm00023
    • 2022-02-18
    153 min

    [JUL-871]Arrogant CEO Of A Partner Company Gets Non-stop Creampie Loads For Entertainment On A Business Trip. Large-scale Exclusive, The Beauty Of A Good Woman In A Professional Suit. An Komatsu

  • anzu komatsu censoredcreampiemature womanJULmadonnahimu lockJUL-871JUL871jul00871
    • 2022-03-04
    124 min

    [SSIS-350]Mixed Body Fluids, Deep Sex: Complete No-cut Special - Suzu Aiho

  • aiho tin censoredbeautiful girlsingle workSSISs1 no 1 stylemon cSSIS-350SSIS350ssis00350
    • 2022-03-22
    86 min

    420ERK-005 あい(22) 素人ホイホイ・えろきゅん・素人・美少女・清楚・ピュア・ガチイキ・色白・ショートカット・顔射・ハメ撮り

  • amateur censoredamateurbeautiful girlerkerk-005erk005420erk-005



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored