jav javcensored high visio amateur nampa




FC2CHRVRBDFSDSSPREDDTTSANAWDVEMAMILKMIAAAUKGNACRVENUMARAPPPDAUKSMEYDGMEMDASDAPOD

2020-11-12
101 min

[ZEAA-055]Married Woman BUKKAKE - Group Semen Play With The Boss' Plump Wife - Ayaka Makimura

  • ayaka makimura censoredcreampiemarried womanZEAAcenter villagesky cloudsthe pole center villageZEAA-055ZEAA055h-086zeaa00055
    • 2020-11-20
    115 min

    [PARATHD-3032]The Beautiful Advisor At The Custom Lingerie Shop Is A Lesbian! She Gets Horny After Toying With Female Customer's Tits

  • censoredamateurlesbianPARATHDparadise tvPARATHD-3032PARATHD3032parathd03032
    • 2020-11-27
    46 min

    [opcyn-122]うらら(24)

  • amateur censoredcreampieamateuropcynopcyn-122opcyn122opcyn-122
    • 2020-11-28

    C0930 ki201128 Self Shot

  • amateur uncensoredc0930
    • 2020-12-12
    150 min

    [EBOD-784]Busty Pre-School Teacher Can't Resist Servicing Her S*****ts' Daddies' Dicks! Her Big Tits Bounce With A Smile In This E-BODY Exclusive Debut - Don't Tell The Little Ones How Hard She Cums - Squirting In Her First Film! Kaor

  • momota kaori censoredbig titssquirtingEBODe bodytrendy yamaguchiEBOD-784EBOD784ebod00784
    • 2020-12-15
    95 min

    261ARA-468 [Active female college student] 21 years old [100 God big breasts] Ayase-chan is here! The reason for her application, which insists too much on cleavage from the beginning, is “I want to show you my boobs ♪” Hentai-chan with boo

  • amateur censoredbig titsamateuraraara-468ara468261ara-468
    • 2020-12-20
    140 min

    [DASD-787]Fresh Face: The Mysterious Beautiful Girl With Pink Nipples Hinata

  • censoredbeautiful girlDASDdasrokusaburo mishimaDASD-787DASD787dasd00787
    • 2020-12-25
    88 min

    [SACA-017]My Younger Sister Has Such Flat Breasts!/Natsuki

  • censoredSACAorustak picturesSACA-017SACA017
    • 2021-01-01
    37 min

    359TYVM-118 Neat and clean bitch cheating wife carnivorous mala eating cum shot sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-118tyvm118359tyvm-118
    • 2021-01-12
    133 min

    [FONE-130]Yurina Is A Cunning Lolita Big Tits Tuber Who Is Super Popular With Dirty Old Men Leaked Offline Fuck Fest Videos *Super Valuable Videos From An Already-Banned Account

  • censoredcreampiebig titsFONEfirst starplus first starFONE-130FONE130h-491fone00130
    • 2021-01-20
    99 min

    [MOKO-033]If You Show Your Cock To A Beautiful Mature Woman In A Private Men's Mature Woman...

  • censoreduniformamateurMOKOstar paradisebumpy roadMOKO-033MOKO033h-254moko00033
    • 2021-01-24
    59 min

    HEYZO 2446 Dirtying A No Face Showing Amateur Girl – Satsuki Okabe

  • satsuki okabe uncensoredheyzo
    • 2021-02-12
    135 min

    [REAL-759]Fucking A Whole Family

  • ichika matsumoto yui nagase censoredbeautiful girlREALreal workstrendy yamaguchireal real worksREAL-759REAL759172real00759
    • 2021-02-19
    27 min

    359TYVM-132 Itsuki

  • amateur censoredcreampiebig titstyvmtyvm-132tyvm132tyvm-132
    • 2021-02-20
    75 min

    FC2PPV 1693868 [No individual shooting, I can only see it here, but lewd mature woman leaked w] I have not heard! I hate it! I made a former Yan Mama beautiful mature woman attack a subordinate of a big cock w But w I got caught in front of a big dic

  • amateur uncensoredfc2
    • 2021-03-18
    75 min

    326URF-061 [Back customs x erotic god GAL advent ☆] The best gal with a personality that kills sperm with full service! Sensation with lewd Kansai dialect ⇒ Paipanma ● 4 shots with SEX swamp loop of vaginal cum shot! !! After all, the hit lady is a b

  • amateur censoredcreampiebig titsurfurf-061urf061326urf-061
    • 2021-04-17
    118 min

    [HND-978]Cuckholding Video Of Girlfriend Being Given Aphrodisiacs And Fucked By A Man She Hates Over And Over Rika Mari

  • mari rika censoredcreampiebeautiful girlHNDhon nakabacon tanakaHND-978HND978hnd00978
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    163 min

    [SSIS-056]Creamy Aphrodisiac Lotion Leads To Endless Slick Orgasmic Sex Rena Kodama

  • kodama rena censoredsquirtingbeautiful girlSSISs1 no 1 stylebungo maedaSSIS-056SSIS056ssis00056
    • 2021-05-10
    120 min

    [HSM-028]Beautiful Horny Transsexual Slut Hime Dot Love Aya Sakuragi Revealed

  • censoredcreampieamateurHSMhot entertainmentshimabukuroshimabukuroHSM-028HSM02859hsm00028
    • 2021-05-15
    145 min

    [SOAN-058]Fleshy Anal Double Hole Sex Elegant Older Slut Makes Her Exciting Ass Fucking Debut! Shiori Mizuki

  • viewing moon bookmark censoredsingle workSOANyama to soramaketaro tanizokoanal visitSOAN-058SOAN058soan00058
    • 2021-05-26
    36 min

    FC2PPV 1837553 [No] [Limited to 100 pieces 2980 → OFF to 2480pt!] Great response! The daughter of "I sell my virginity" … is back as a lewd man! ♥ ️ Best masterpiece! * Review benefits / High image quality Ver

  • amateur uncensoredfc2
    • 2021-06-01
    120 min

    [NACR-426]Sex With Son's Wife The Day My Formerly Kind Father-in-Law Turned Into A Monster Akane Shiki

  • akane shiki censoredcreampieblowjobNACRplanet plusbito sakurananakuruNACR-426NACR426h-237nacr00426
    • 2021-06-04
    170 min

    [DVDMS-673]A Normal Boys And Girls Focus Group Adult Video Everyone's Favorite Big Tits Female Managers Only! During Training Camp, Would You Go Into The Men's Bath And Take Care Of The Team Members' Cocks By Using Your Big Tits And Givin

  • censoredcreampiebig titsDVDMSdeep ssuttorune iwanagaDVDMS-673DVDMS673dvdms00673
    • 2021-06-12
    121 min

    [VEO-043]Real Married Amateur's Porn Debut! She Lures Customers To Her Cafe With Her Big Tits And Big Booty - She's So Prim, Pretty, And Cute You'd Never Expect She Loves To Gobble Cock - Barista Married For 7 Years, Chiharu Ito

  • chiharu ito censoredcreampiebig titsVEOvenuspeterbornVEO-043VEO043veo00043
    • 2021-06-15
    47 min

    481SACZ-040 Sachiyo 6

  • amateur censoredamateurmature womansaczsacz-040sacz040481sacz-040
    • 2021-06-20
    76 min

    [KAZK-063]I Ordered A Masseuse For My Step Grandmother For Her Birthday And Asked Him To Give Her A Sexual Massage... Toyo Nozawa (62)

  • nozawa notoyo censoredmature womansingle workKAZKstar paradisekazokuKAZK-063KAZK063h-254kazk00063
    • 2021-06-22
    65 min

    FC2PPV 1882733 [Great breasts ♥] G cup older girlfriend [Magazine model] On the table, even if it is a type that is laid on the buttocks, it is very cute when it is etched ♀ Big breasts trembling and vaginal cum shot SEX leaked from saffle Personal s

  • amateur uncensoredfc2
    • 2021-06-22
    58 min

    499NDH-024 Mouth Service is the Best Proof of Love! Axillary, navel, fingers, rimming, licking and sucking large-scale behavior! Saddle tide dripping raw Saddle hope Ma ○ Ko is pierced with a gun and facial cumshots on a too licking beauty who expres

  • amateur censoredcreampiesquirtingndhndh-024ndh024499ndh-024
    • 2021-07-02
    133 min

    [HODV-21590][Full POV] Girls Speaking In Dialect: The Hiroshima Dialect - Ai Tsubakino

  • tsubaki no ai censoredcreampiesingle workHODVh m pHODV-21590HODV215905642hodv21590
    • 2021-07-05
    57 min

    493NAEN-071 Gal hole! ？？ Creampie appeal JD! ？？ Ikuiku disease is not good with a big cock ○ Massive vaginal cum shot Yui Satonaka

  • amateur censoredamateurbeautiful girlnaennaen-071naen071493naen-071
    • 2021-07-05
    82 min

    493NAEN-070 yen! ？？ Kansai dialect J ○ K raw vaginal cum shot! ？？ Sensitive busty girl who cums once a minute ○ Raw Ishihara Nozomi

  • amateur censoredamateurbeautiful girlnaennaen-070naen070493naen-070
    • 2021-07-09
    118 min

    [DASD-886]I was seduced into a reverse NTR by the female employee I ended up sharing a room with at the hot spring resort during our business trip. Even though I have a loving wife, I'm continually seduced by my female employees and I end up thru

  • toua kotone censoredcreampiebeautiful girlDASDdasmishima rokusaburoDASD-886DASD886dasd00886
    • 2021-07-12
    129 min

    [SHN-067]Sensitive (Shame) Big Titted Sluts 2021: Hot Springs Customer JD (Approximately F Cup)/Soccer Club Manager (Approximately F Cup)

  • censoredbig titssquirtingSHNnatural highkansukenatsu carefully selected daughterSHN-067SHN0671shn00067
    • 2021-07-17
    119 min

    [HMN-021]Fucked Straight After First Meeting! Immediate Cumming! Right after the First Creampie, the Hard Fucking Resumes! "I'm already cumming!" But the Fucking Goes on with Another Creampie! Mai Kagari

  • flower hunting censoredcreampieuniformHMNhon nakatiger kosakaiHMN-021HMN021hmn00021
    • 2021-07-27
    240 min

    [SDAB-190]Developing Body, Uncertain Beautiful Girl 18 Years Old SOD Exclusive AV Debut Rin Momono [Get Off To Impressive 4K Video!]

  • rin momono censoredbeautiful girlSDABsod createSDAB-190SDAB190
    • 2021-07-30
    228 min

    [BBAN-338]Masochist Girl With Big Ass And Huge Tits Lesbian Beauties - Please Fuck Me Too. Like You Fuck Her - Yui Nagase Hina Kawai Hono Wakamiya

  • yui nagase haruna kawai censoredschoolgirllesbianBBANbibianBBAN-338BBAN338bban00338
    • 2021-08-07
    126 min

    [NKHB-006]Super-Rare Top-Class Chubby Amateur. Aika chan.

  • censoredcreampiebig titsNKHBnikuatsu shokudou mousozokuNKHB-006NKHB006nkhb00006
    • 2021-08-20
    51 min

    FC2PPV 2052614 * Weekend Limited 6000⇒3980 ★ First Shot ☆ Miraculous Thirty Beauty ♥ Former Race Queen ♥ Gokubi Body Towako 32 Years Old ♥ Exciting! Continuous Iki ♥ De M Irama’S Drooling Lust ♥ Excited Mass Cum Shot ♥ * 2 Consecutive Blowjobs W

  • amateur uncensoredfc2
    • 2021-08-21
    28 min

    FC2PPV 2057112 [Uncensored] Umeda Freeter ② (Video Of Support 〇 That Is Vaginal Cum Shot And Reinserted For Money …)

  • amateur uncensoredfc2
    • 2021-09-04
    58 min

    10musume 090421_01 Undeveloped Girl Whose First Experience Was 18 Years Old Sai Kurashina

  • amateur uncensored10musume
    • 2021-09-11
    110 min

    [NSFS-024]Mature Mother 14 - A Stepmother Who Loved Her New Husband"s Son - Yuki Kurosawa

  • kurosawa snow censoredmature womansingle workNSFSnagae styletomitake taroNSFS-024NSFS024nsfs00024
    • 2021-09-17
    116 min

    [PRED-341](Last Day On Business Trip) Unexpected Temptation From Room Sharing With Female Boss. Cowgirl All Night Long Till Morning. Giving In To Endless Creampie Action. Kano Kashii

  • kashii hanano censoredcreampiesingle workPREDpremiumsapporo tarouelegancePRED-341PRED341pred00341
    • 2021-09-18
    100 min

    [SUJI-142]S*****t Ten Gets A Dirty Creampie Or Two From The Father And The Brother Of Her Friend

  • hasumiten censoredcreampiesingle workSUJIkan ran monoSUJI-142SUJI142suji00142
    • 2021-09-20
    59 min

    539INSF-002 Sae

  • amateur censoredbig titsamateurinsfinsf-002insf002539insf-002
    • 2021-09-25
    72 min

    H0930 tk0042 Rina Tosano 31years old

  • amateur uncensoredh0930
    • 2021-11-02
    74 min

    374IMGN-029 AYAME (23) (Ayame Kinoshita)

  • amateur censoredmarried womanamateurimgnimgn-029imgn029374imgn-029
    • 2021-11-06
    59 min

    Pacopacomama 110621_555 First Document By Amateur Wife, 94: Ai Yamamoto

  • amateur uncensoredpacopacomama
    • 2021-11-17
    69 min

    FC2PPV 2441352 Hold 3 Times Until Registration! !! Midnight [Don Quixote Musume] I Was Stunned By A Large Number Of Facial Cumshots At A Hotel When I Was Called By An Unknown Elderly Person …

  • amateur uncensoredfc2
    • 2021-11-24
    122 min

    [MTALL-002]Teased And Edged Over And Over! This Devilish Slut Will Rim Your Anal Hole And Suckle Your Nipples To Fulfill Your Submissive Creampie Desires Ichika Matsumoto

  • amateur censoredcreampiebeautiful girlMTALLmateriallMTALL-002MTALL002
    • 2021-12-01
    126 min

    [AMBI-147]Runaway Girl And Old Guy Small Love Story. Tsurara Kanon

  • hanaoto urara censoredcreampieschoolgirlAMBIplanet plusdirector oanbibarentsuAMBI-147AMBI147h-237ambi00147
    • 2021-12-24
    91 min

    300MIUM-763 Good Face! Nori Is Good! Good Body! All Are Five-Star Class Super Erotic Gal! Squeeze Sperm At The Woman On Top Posture That Shakes The Huge Breasts E Cup! Paipanma Who Is Too Sensitive ● Ko Is Always Squirting Cum! Defeat Saddle Until Mo

  • amateur censoredbig titssquirtingmiummium-763mium763300mium-763
    • 2022-01-01
    160 min

    [LULU-115]Wife Looking To Start Fresh On Her Second Marriage Has A Step-daughter With A Big Ass That Is Just Too Good, Now She"s My Favorite Step-daughter Who Sucks Me Down Her Throat And Swallows My Cum Loads Every Day. Yui Tenma

  • yui tenma censoredcreampieschoolgirlLULUlunaticsluminaxLULU-115LULU115lulu00115
    • 2022-01-07
    124 min

    [IPIT-024]A Lot Of Cumming! Idols Beautiful Girl"s Acme Development 3 Times! Special 10L Peeing! Mei Uesaka

  • mei uesaka censoredsquirtingbeautiful girlIPITidea pocketmichiru arashiyamaideapocket talent discovery projectIPIT-024IPIT024ipit00024
    • 2022-01-07
    93 min

    [VENX-107]Rawdogging My Hot Stepmom While We Have The House To Ourselves, Starring Mai Kagari

  • flower hunting censoredcreampiemature womanVENXvenuspeterfakecest winntersVENX-107VENX107venx00107
    • 2022-01-21
    240 min

    [HUNTB-193]The Second I Wake Up My Obedient Younger Stepsister Sucks My Dick As We Start Our Daily Routine Of Fucking Each Morning! Spending Time To Get Finished Off By My Sexy Stepsister That Loves To Get Lewd With No One Else But Me...

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-193HUNTB193huntb00193



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored