jav javcensored high vision squirting creampie




FC2CHRVNATRHDKAMEYDSPRDDASDSTARSNACRWAAAAMBIPPPDJULVENUNGODAUKSKBIONEZSQTEHODVNACX

2020-09-05
159 min

[BBAN-292]My Little Stepsister Is Lusting For My Body And Today, She's Coming For Me With Kisses And Smiles... As We Lose Ourselves In Hot Smothering Kisses, These Immoral Stepsisters Climax Together In The Lesbian Series Mizuki Yayoi Mitsuki Nag

  • mizuki yayoi scooping censoredlesbiansisterBBANbibianBBAN-292BBAN292bban00292
    • 2020-09-16
    99 min

    [MXGS-1153]A Popular Adult Video Actress Who Knows Nothing Gets Piston-Pumping Quickie Sex So Hard It Breaks The Bed Mizuki Yayoi

  • mizuki yayoi censoredbeautiful girlsingle workMXGSmaxingkeiha nobuyoMXGS-1153MXGS1153h-068mxgs01153
    • 2020-09-22
    119 min

    [SDDE-632]Close-Up Cowgirl Sex Treatment, While Holding The Patient's Hand... Close Contact 3-Day Fuck Clinic With Nurse Rin Kira

  • kira rin censoredblowjobhandjobSDDEsod createryo inugamisenzSDDE-632SDDE6321sdde00632
    • 2020-09-26
    60 min

    SIRO-4273 [First shot] [Weather caster] [Sensitive body inevitable in flames] A model-like small-faced beauty who aims to become a weather forecaster. Innocent Ma ○ who was unaware of the climax, when I teach serious sex .. AV application on the net

  • amateur censoredamateursirosiro-4273siro4273siro-4273
    • 2020-10-20
    180 min

    [FUFU-193]If You Trick Your Older Wife Into Taking Care Of Your Sick Friend, And Leave The Two Of Them Alone... 180 Minutes

  • censoredamateurFUFUstar paradisefufuFUFU-193FUFU193h-254fufu00193
    • 2020-11-11
    69 min

    259LUXU-1338 Luxury TV 1325 A neat and intelligent local announcer makes her first AV appearance with a tense look! !! Exposing an embarrassing pose in front of the camera and dyeing her cheeks, the sensitive body of slender beautiful breasts blows t

  • amateur censoredamateurluxuluxu-1338luxu1338259luxu-1338
    • 2020-11-13
    113 min

    [CESD-944]Yui Hatano x Mihana They Both Get Horny When They're Tipsy... Two Lesbian Ladies Get Liquored Up Together For Hot, Steamy Sex!

  • yui hatano mihina azumihina mihina nagai censoredlesbianmature womanCESDceleb no tomoCESD-944CESD944cesd00944
    • 2020-11-20
    115 min

    [PARATHD-3032]The Beautiful Advisor At The Custom Lingerie Shop Is A Lesbian! She Gets Horny After Toying With Female Customer's Tits

  • censoredamateurlesbianPARATHDparadise tvPARATHD-3032PARATHD3032parathd03032
    • 2020-11-21
    73 min

    FC2PPV 1578800 ☆ The 4th in the brewing series! ☆ This is the last look ♥ Sensitive instant wet slender beauty OL’s first 3P in my life was disturbed ♥ [with ZIP]

  • amateur uncensoredfc2
    • 2020-11-24
    71 min

    10musume 112420_01 The Structure Of Woman : Loli face girl’s body is also Loli body Keiko Miyahara

  • amateur uncensored10musume
    • 2020-12-02
    137 min

    [GVH-156]The Sexy PTA Chairwoman & A Mind-Blowing Hot Teacher Get Teamed By The S*****t Council Brats Ayane Sezaki/Mizuki Yayoi

  • ayane sezaki mizuki yayoi censoreddramaGVHglory questhyonGVH-156GVH15613gvh00156
    • 2020-12-05
    47 min

    C0930 ki201206 ki201206 33years old

  • amateur uncensoredc0930
    • 2020-12-05
    77 min

    476MLA-021 [Pool Nampa] The strongest swimsuit gal in the eyes is Momojiri Grind Cowgirl! !! A large amount of love juice soaked in the sheets … Midsummer SEX where the sensual Aegi voice echoes and the slender body jumps! !! !!

  • amateur censoredamateurmlamla-021mla021476mla-021
    • 2020-12-11
    102 min

    [SKEJ-004]I Just Wanted To Have Some Intense SEX

  • censoredcreampiebig titsSKEJamateur time delusion groupSKEJ-004SKEJ004skej00004
    • 2021-01-05
    86 min

    261ARA-470 [Mecha Kawa Bishoujo] 19 years old [Smile becomes a habit] Chiharu-chan is here! The reason for her application to become a voice actor in the future is “Recently, I’m hungry …” Is the man food？ Especially 19 years old

  • amateur censoredamateuraraara-470ara470261ara-470
    • 2021-01-16
    113 min

    [ROYD-037]I Confessed My Love For The First Time To The No.1 Slut At School! "If We're A Good Match Sexually, I'll Go Out With You!" And Then She Gave My Cherry Boy Cock A Test Ride! Yui Kawai

  • yui kawai censoredcreampieschoolgirlROYDroyalcognac kaminohhh groupROYD-037ROYD037royd00037
    • 2021-01-22
    477 min

    [HRV-055]Me And This Totally Beautiful Girl In An Abnormal World Of Sex Best Hits Collection 8 Hours Vol.01 The Strongest And Most Sexy Are Breaking Through All The Erotic Barriers On Earth!!! A 480-Minute Journey Into The World Of The Abnormal!!!

  • suzumura airi maria aine censoredcosplayHRVprestigemichiru sunharvestHRV-055HRV055118hrv00055
    • 2021-01-22

    FC2PPV 1654888 [Personal shooting] A fair-skinned bristle man hair beautiful girl is made into a toy of two stranger sticks.

  • amateur uncensoredfc2
    • 2021-01-31
    140 min

    [MMUS-048]Young Beautiful Succubus Rei Kuruki

  • satoshi kuruki censoredcosplayslutMMUSmarrionkijin kasaikcpMMUS-048MMUS048mmus00048
    • 2021-01-31
    121 min

    [KSBJ-115]Tiger Stepmom's Strict Sex Education Ryo Hitomi

  • ryo hitomi censoredblowjobmature womanKSBJksb kikaku emmanuellebito sakuraKSBJ-115KSBJ115ksbj00115
    • 2021-02-05
    243 min

    [HEZ-252]Hot Babes With Wild Booty - 12 Girls With Top-Grade Asses

  • censoredbig titsHEZhot entertainmentcompany matsuoHEZ-252HEZ25259hez00252
    • 2021-02-09
    127 min

    [STARS-326]I Happened Upon My Girlfriend's Little Sister As She Came Out Of The Bathtub, And There She Was, Without Her Bra On, And I Couldn't Control My Erection, And When I Asked For Sex, She Bashfully Agreed, Because She Was Horny Too, And

  • hikari aozora censoredcreampiesingle workSTARSsod createeasy matsumotosod starSTARS-326STARS3261stars00326
    • 2021-02-12
    85 min

    [ZOZO-041]Miss Mio Ichijo

  • censoredcreampiebig titsZOZOsadie willenauZOZO-041ZOZO0411zozo00041
    • 2021-03-09
    140 min

    [STARS-334]Quick Fuck While On The Way To The Bathroom! Unable To Stand The Pleasure She Pisses Herself While Cumming! Ichika Nagano

  • ichika nagano censoredbeautiful girlsingle workSTARSsod createkyoseisod starSTARS-334STARS3341stars00334
    • 2021-03-09
    140 min

    [KIRE-024]Blowjob Master Reveals Her Amazing Long Lasting Sucking Technique Using Her Nasty Tongue To Loudly And Sloppily Suck Cock Sumire Kurusu

  • sumire kurusu censoredblowjobsingle workKIREsod createaida yumenobeauty kirei sodKIRE-024KIRE0241kire00024
    • 2021-03-12
    126 min

    [GMBM-001]Daydream Explosion My Step Sister Always Walks Around Naked And I Don't Know Where To Look! Monami Takarada

  • takarada monami censoredcreampiebig titsGMBMmercurybirdman teppeinaked familyGMBM-001GMBM001h-1133gmbm00001
    • 2021-03-12
    84 min

    [ETQR-204](Daydream POV) Sex For Money WIth A Runaway Girl Suzu-chan

  • censoredcreampieuniformETQRerotic timeETQR-204ETQR204h-1186etqr00204
    • 2021-03-13
    172 min

    [IPX-624]Innocent Beautiful Y********l In Uniform Seduced By Her Masseur Through An Erotic Oil Massage... Her Ecstatic, Orgasmic Shivers Don't Stop... Ema Futaba

  • futaba emma censoreduniformbeautiful girlIPXidea pocketgoemondishIPX-624IPX624ipx00624
    • 2021-03-14
    37 min

    279UTSU-497 Misakin

  • amateur censoredcreampiebig titsutsuutsu-497utsu497279utsu-497
    • 2021-03-17
    73 min

    [opcyn-160]るな 2(28)

  • amateur censoredamateuropcynopcyn-160opcyn160opcyn-160
    • 2021-03-19
    99 min

    [VENX-017]Step Son Becomes Guinea Pig For Step Mother Becoming A Prostitute Maho Kanno

  • maho kanno censoredcreampiebig titsVENXvenussarufakecest winntersVENX-017VENX017venx00017
    • 2021-03-23
    48 min

    Pacopacomama 032321_450 Married Pussy Encyclopedia : Deluxe Edition Kanon Mikoshiba

  • amateur uncensoredpacopacomama
    • 2021-04-02
    153 min

    [SSIS-027]Minami Kojima 's PLATINUM SOAP

  • minami kojima censoredhandjobsingle workSSISs1 no 1 stylelamb chopSSIS-027SSIS027ssis00027
    • 2021-04-09
    189 min

    [UMD-775]Giving Into Her Lust For Dick Even Though Her Husband Is Right Near By! Slutty Wife Broken In By Another Man's Dick And Does Whatever He Wants

  • miho tsuno kaori oishi censoredmarried womanUMDleotaboo osakiUMD-775UMD775125umd00775
    • 2021-04-11
    61 min

    413INST-112 [Active Model] Small Married Woman NTR Leaked Gonzo Private Personal Photo Session Creampie

  • amateur censoredcreampiemarried womaninstinst-112inst112413inst-112
    • 2021-04-15
    76 min

    [REBD-548]Sora Spotlight Is Calling Me - Sora Minamino

  • minano sora censoredsingle workREBDrebeccachikara sawamuraREBD-548REBD548h-346rebd00548
    • 2021-04-27
    120 min

    [PAIS-003](Forum Posting) I Tried Secretly Filming A Busty, Charismatic Brothel Babe, But When She Caught Me Dominated Me Beyond My Wildest Dreams *If Leaked To The Brothel, This Will Get Taken Down

  • censoredbig titsamateurPAISmercurycricketpie otsukai day clubPAIS-003PAIS003h-1133pais00003
    • 2021-05-02
    240 min

    [PKPD-143]Sugar Baby Highlights 2 18 Year Old Girls Who Are Okay With Being Fucked Raw 240 Minutes

  • minami kosaka momoe kotori censoredcreampiebeautiful girlPKPDpakopako team and pleasant friends delusion groupPKPD-143PKPD143pkpd00143
    • 2021-05-21
    118 min

    [NNPJ-452]"I Want You To Fuck My Brains Out" I Seduced A Beautiful Married Woman Who Turned Out To Be A Horny Cunt And Kept On Demanding Second Helpings Until The Break Of Dawn!？ Hit The REC Button On Some Orgasmic Ecstatic POV Fucking. (The

  • censoredcreampieamateurNNPJnanpa japanNNPJ-452NNPJ452nnpj00452
    • 2021-05-27
    157 min

    [fc2-ppv 1837970]【お買い得】緊急事態宣言再延長セール！！3Qから怒涛の3SEX！ FC2-PPV-1837970

  • amateur uncensoredfc2
    • 2021-05-30
    61 min

    HEYZO 2535 Do Me A Favor？ Dangling Money In Front Of An Amateur Girl!! – Rui Minazuki

  • rui minazuki uncensoredcreampiehandjobheyzo
    • 2021-06-20
    240 min

    [NASH-528]Elegy For A Showa Wife - She Repays Her Husband's Loans With Her Body - Ravished By His Boss, His Lender, And Even A TV Reporter

  • censoredbig titsdramaNASHnadeshikocharlie miyazakiNASH-528NASH528nash00528
    • 2021-06-26
    67 min

    SIRO-4528 [First shot] [Geki Kawa rookie OL] [Fair-skinned beautiful breasts] A large rookie from the sales department who drops a man with a cute face that leaves a young child participates in the war. She holds her finger and fascinates her serious

  • amateur censoredamateursirosiro-4528siro4528siro-4528
    • 2021-07-10
    130 min

    [AVSA-172]SUPER FISHEYE FETISHISM Voluptuous Nympho Nurse's Thick Curves Honami Akagi

  • honami akagi censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-172AVSA172avsa00172
    • 2021-07-10
    147 min

    [SCOP-729]"Nipple Aphrodisiac" - An aphrodisiac that will turn nipples into clitorises and make the young housewives of the neighborhood who taste it climax! These horny young housewives whose nipples become like clitorises won't be able

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-729SCOP729scop00729
    • 2021-07-14
    66 min

    494SIKA-100 Revenge On Your Boyfriend! Look At Me Squirming With Another Stick

  • amateur censoredcreampieamateursikasika-100sika100494sika-100
    • 2021-07-18
    120 min

    [BLB-010]Huge Black Cock - Japanese MILF Ravished In Return For Her Husband's Debts. Shameful Four-Some G*******g This Married Woman Will Never Recover From (Her First Experiences With A Black Man!) Nao Nakano

  • nanao nakano censoredmature womansingle workBLBglobal media entertainmentjiro sadogashimablack beastBLB-010BLB010blb00010
    • 2021-07-24
    106 min

    300NTK-610 [Summer Big Tits Gal Assortment! !! Outdoor 6p Big Orgy Sp Of All G Over De Nasty Gal X 3! !! ] Exactly Sake Pond Meat Forest! !! Gal From The Right! !! Gal! !! Gal! !! Yes Heaven For All G Milk And Above! !! It’S Okay To Touch With T

  • amateur censoredcreampiebig titsntkntk-610ntk610300ntk-610
    • 2021-09-08
    106 min

    428SUKE-087 [Chest / Butt / Sensitivity ← Gold Medal Class! ？？ ] Borrow A Mobile Battery And Samurai Girls And Pakopako Sp! !! Are You Aiming For Nani’s Gold Medal Four Years Later？ Cowgirl？ !! Belotech？ !! I Love Flirting! !! With Quick Charge

  • amateur censoredcreampiebig titssukesuke-087suke087428suke-087
    • 2021-09-08
    115 min

    241GAREA-521 Kannya

  • amateur censoredamateurbeautiful girlgareagarea-521garea521241garea-521
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-21
    58 min

    HEYZO 2612 Pumping Into A Needy MILF – Nagisa Shinohara

  • amateur uncensoredcreampiehandjobheyzo
    • 2021-09-24
    161 min

    [HMN-041]Young Lady Who Works At Traditional Japanese Restaurant In Nihonbashi, Tokyo Rima Kamishiro

  • kamidai rima censoredcreampieblowjobHMNhonnakamamezawa mametarouHMN-041HMN041hmn00041
    • 2021-09-30
    23 min

    FC2PPV 2273468 [Unauthorized Leak] That Famous Youtube Couple Gonzo Video * Limited Quantity

  • amateur uncensoredfc2
    • 2021-10-15
    153 min

    [BLK-527]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 08

  • censoredcreampiesquirtingBLKkira kirakira hosi kira black galBLK-527BLK527blk00527
    • 2021-11-06
    154 min

    [MDBK-207]Explosive Nookie Ejaculation Skills, Used To Toy With Men While They"re Tied Up Welcome To The Titty Fuck Club, A Brick And Mortar Palace Of Pleasure Where You"ll Be Subjected To Slick And Slippery Titties To Get You Hot And Excited

  • tsujii honoka inaba censoredbig titsslutMDBKk m producebazookaMDBK-207MDBK207mdbk00207



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored