jav javcensored vibe masturbation censored




FC2NATREBODDASDWANZNGODHUNTBGMEMSPRDBBANAUKGRBDCHRVWAAASHKDAWDMIDVFSDSSMILKNACXVENX

2020-10-25
43 min

330PER-327 Toa

  • amateur censoredamateurperper-327per327330per-327
    • 2020-11-13
    240 min

    [MBM-234]Generating Fantastic Sales On Streaming Websites Legendary Housewife Pick Up Godlike Films Best Selection 04 12 Girls 4 Hours

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-234MBM234118mbm00234
    • 2020-11-19
    135 min

    [SORA-282]I Want To Show Off: An Exhibitionist Diary - Mizuki Sanada

  • mizuki sanada censoredbig titsslutSORAyama to sorahimu lockSORA-282SORA282sora00282
    • 2020-12-01
    111 min

    [SCR-257]A Married Woman Falls At A Hot Springs Inn! Unscrupulous Oil Masseuse Voyeur Video

  • censoredcreampieSCRglay zs crimeSCR-257SCR25712scr00257
    • 2020-12-03
    60 min

    413INST-075 [Orgy / Personal shooting] The duo ♀ pussy is all spear man ★ The female college student who took out is too erotic with a neat bitch of Bli Bli! If you ejaculate with a vaginal cum shot, you will be shocked by the white eyes and cum acme

  • amateur censoredcreampiebig titsinstinst-075inst075413inst-075
    • 2020-12-04
    128 min

    [HODV-21531]"We Just Missed The Last Train Home... Do You Want To Cum Over？" After Missing My Last Train Home, I Ended Up Spending The Night At My Lady Boss' Place, And Since Her Husband Was Away On Business, We Ended Up Committing Adulte

  • ai mukai censoredcreampieslutHODVh m pinugami ryouHODV-21531HODV215315642hodv21531
    • 2020-12-04
    52 min

    [oretd-807]NAKAJOU

  • amateur censoredcreampieamateuroretdoretd-807oretd807oretd-807
    • 2020-12-09
    80 min

    FC2PPV 1599806 [Limited to 3 days] I really did it when I persuaded a black gal dancer & Ibecon woman (^ _-)-☆

  • amateur uncensoredfc2
    • 2020-12-17
    240 min

    [DVDMS-609]Faces Shown! One-Way Mirror Flight - Prim Pretty Department Store Clerks Working In The Beauty Department - Their First Deep Kiss Edition - Vol. 02 8 Stars, Everyone Gets Laid Special! Moist, Beautiful Lips Locked In Passionate Hot Smother

  • censoredamateurDVDMSdeepsfunky haseithe magic mirror mm mm flightsDVDMS-609DVDMS609dvdms00609
    • 2020-12-21
    53 min

    FC2PPV 1615004 ☆ Reunited with that girl who was out of touch ☆ I received a pleasant Christmas gift from a sensitive beautiful girl Santa with fair skin ♥ [With review benefits]

  • amateur uncensoredfc2
    • 2021-01-01
    120 min

    [HDKA-224]Naked Home Visiting Caregiver - Shoko Ueki

  • shoko ueki censoredcreampieblowjobHDKAplanet plusdirector onudityHDKA-224HDKA224h-237hdka00224
    • 2021-01-05
    36 min

    FC2PPV 1633318 [First two cocks at the same time! Complete appearance → It’s really dangerous if you get caught] Former Race Queen JD 3rd advent ❤ Shamefully double blowjob with both hands & mouth pussy! Oil Nyuru Nyuru Finger Man Blame Shri

  • amateur uncensoredfc2
    • 2021-01-16
    58 min

    Caribbeancom 011621-001 Creampie SEX with Fcup gorgeous body girl Riri Shiraki

  • riri shiraki uncensoredcreampiecaribbeancom
    • 2021-01-22
    477 min

    [HRV-055]Me And This Totally Beautiful Girl In An Abnormal World Of Sex Best Hits Collection 8 Hours Vol.01 The Strongest And Most Sexy Are Breaking Through All The Erotic Barriers On Earth!!! A 480-Minute Journey Into The World Of The Abnormal!!!

  • suzumura airi maria aine censoredcosplayHRVprestigemichiru sunharvestHRV-055HRV055118hrv00055
    • 2021-01-23
    239 min

    [MCSR-425]Sudden Surreptitious Finger-Banging! 2 - Knowingly Or Not, Two MILFs Go To A Pick-Up Bar For Liquor And Ended Up Getting Fucked 6 Pairs, 12 Mature Girls, 4 Hours

  • censoredmature womanMCSRbig morkalfinger banging naughty taromascottMCSR-425MCSR42557mcsr00425
    • 2021-01-28
    96 min

    485GCB-007 Inevitable love! !! Geki Kyawa Duero F Cup Actress vs 43 Years Old Uncle Virgin! Yuri Manga will drop the uncle who has been agitated both physically and mentally with his own charm and erotic tech! !! When the erotic switch is turned on,

  • amateur censoredbig titsamateurgcbgcb-007gcb007485gcb-007
    • 2021-01-28
    45 min

    C0930 ki210128 Mayumi Ono 30years old

  • amateur uncensoredc0930
    • 2021-01-29
    50 min

    FC2PPV 1659821 [No] Spree a teenage girl with an old man’s cock! Inject sperm into the mouth and pussy respectively! It’s Eloy without a bottom, Aya-chan! The best meat urinal! !! 【selfie】

  • amateur uncensoredfc2
    • 2021-02-16
    137 min

    [STARS-328]I'm A Married Man, But While On A Business Trip, I Met This Outgoing Local Beauty At A Local Snack Bar, And Spent 2 Nights Fucking Her Brains Out At A Hot Spring Resort Mei Miyajima

  • mei miyajima censoredbeautiful girlsingle workSTARSsod createbacon tanakasod starSTARS-328STARS3281stars00328
    • 2021-03-05
    55 min

    328HMDN-342 Male college student x married woman] Devilish boobs married woman Rie 38 years old (pseudonym) Demon 3P orgy party with energetic cock participation

  • amateur censoredcreampiebig titshmdnhmdn-342hmdn342328hmdn-342
    • 2021-03-11
    96 min

    [FUGA-047]Steamy Unforgettable Sex With My Mom's Friend Satomi Sometani

  • satomi someya censoredcreampiemature womanFUGAcenter villageminami daichirakuen center villageFUGA-047FUGA047h-086fuga00047
    • 2021-03-26
    240 min

    [NASH-477]Adultery - Wives' Family Fun -

  • censoredmarried womanmature womanNASHpinknadeshikoNASH-477NASH477h-067nash00477
    • 2021-03-27
    62 min

    1Pondo 032721_001 Great Shooting: Reina

  • amateur uncensored1pondo
    • 2021-04-16
    96 min

    FC2PPV 1773250 [3980 → Weekend limited 1980] Legal Lolita 18 years old ❤️ Around the age of being curious about eroticism ❤️ Continuous acme with doubling sensitivity ❤️ Climbing the stairs of adults at once ❤️ JD entrance examination stress release

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-29
    57 min

    FC2PPV 1794118 Until 5/9 2000off Fair-skinned D cup Kanawo 2nd round

  • amateur uncensoredfc2
    • 2021-04-29
    145 min

    [PXH-026]【フルバージョン】神熱AV女優を1日貸切ひたすら本能の中出し交尾。 ACT.07 最旬AV女優×豊満BODY×生ハメ 鈴木真夕

  • amateur censoredcreampiebig titspxhpxh-026pxh026pxh-026
    • 2021-05-07
    93 min

    [OKS-111]Maika Hizumi Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Enjoy A Cute Girl In A School Swimsuit To Your Heart's Content! Watch Her Change In Peeping Videos, And Check Out Her Tiny Titties, Big Tits, And Shaved Pussy Fun,

  • maika hizumi censoredschoolgirlbeautiful girlOKSdaddy s private photosgoddess in a school swimsuitOKS-111OKS1111oks00111
    • 2021-05-24
    113 min

    420POW-007 Tenten [Family-friendly child / Reliable older sister / Big tits / Neat / School girls / Beautiful girl] Shock! Swamp girl who has sex until the sun goes down! My boyfriend’s penis is too lively and hyperventilation fainting! Deredere

  • amateur censoredbig titsuniformpowpow-007pow007420pow-007
    • 2021-05-29
    103 min

    [VENX-040]Step Son Becomes A Practice Tool For His Step Mother Who Started Working As A Prostitute Asuka Kiyomiya

  • kiyomiya asuka censoredcreampiebig titsVENXvenuspeterfakecest winntersVENX-040VENX040venx00040
    • 2021-06-08
    62 min

    SIRO-4546 [First shot] [Strong gal x beautiful breasts nice ass] A big cock piston that is merciless to a strong gal whose facial expression gradually changes. She is fascinated by her S-class style and panting .. AV application on the net → AV exper

  • amateur censoredamateursirosiro-4546siro4546siro-4546
    • 2021-06-12
    60 min

    383REIW-073 Maya

  • amateur censoredcreampieamateurreiwreiw-073reiw073383reiw-073
    • 2021-06-16
    240 min

    [DVDMS-681]Gorgeous Porn Stars Rei Kuruki And Mizuki Yayoi Break In Male Virgins While Their Families Are Home - If They Get Them Off Without Getting Caught, They Win A Prize! An Extreme Challenge With Beautiful Girls!

  • satoshi kuruki mizuki yayoi censoredcreampiesquirtingDVDMSdeep sostracismDVDMS-681DVDMS681dvdms00681
    • 2021-06-16
    120 min

    [SSIS-100]108 Intense Orgasms! 4800 Spasms! 1500 CC's Of Squirted Pussy Juice! Fair-Skinned Barely Legal G-Cup's Erotic Awakening - Her First Orgasm Special Uta Hayano

  • hayano uta censoredbig titssquirtingSSISs1 no 1 styleichigoharaSSIS-100SSIS100ssis00100
    • 2021-06-16
    80 min

    259LUXU-1423 Luxury TV 1418 A nursery teacher who smiles with a desire to like intense sex has appeared! When blamed for an unusually embarrassing appearance, he dyes his cheeks and is embarrassed, but gradually becomes open with a violent piston and

  • amateur censoredamateurluxuluxu-1423luxu1423259luxu-1423
    • 2021-06-30
    68 min

    FC2PPV 1896857 Until 7/7 2980 [Sanctions] A simple fair-skinned slender beautiful girl. She forcibly commits a frightened woman in large numbers and makes vaginal cum shot for 10 consecutive times.

  • amateur uncensoredfc2
    • 2021-07-08
    116 min

    [GS-394]In Hospital For Pervert Psychosis, And On the Brink Of Losing Control, I Couldn't Believe It When My Hot, Young Nurse Told Me She Could Help Me Relax. "Say Ahh," She Whispered, And Then Plunged Her Tongue Into My Mouth! And I Thou

  • censoredbig titsamateurGSsosoru garcontanburaGS-394GS394h-101gs00394
    • 2021-07-11
    18 min

    FC2PPV 1916968 Three consecutive ejaculations by raw insertion! Twenty-year-old beauty chin straight shakes her hips and cums inside!

  • amateur uncensoredfc2
    • 2021-07-12
    67 min

    345SIMM-653 [NTR] A neat young wife takes a close-up shot naked with the male models she meets for the first time! Unfaithful wife and 3P cum shot SEX [Memorial nude photo shoot]

  • amateur censoredcreampiemarried womansimmsimm-653simm653345simm-653
    • 2021-07-12
    75 min

    FC2PPV 1894485 [individual] Real Aunt 55 Years Old And Sexual Intercourse. A Mature Woman Who Is Estrus To A Man She Knows Since She Was Little And Is Cum Shot By Herself Taken And Released [first Special Price]

  • amateur uncensoredfc2
    • 2021-07-17
    58 min

    C0930 hitozuma1359 Kayo Nakatsui 29years Old

  • amateur uncensoredc0930
    • 2021-07-23

    FC2PPV 1936448 Crying, Regret, 3 Experienced People, Only Boyfriend Experience, First Shooting, First Vaginal Cum Shot In Life, Outstanding Style, Transcendent Beauty, Boyfriend Betrayal First Shooting Vaginal Cum Shot And Tears Of Regret

  • amateur uncensoredfc2
    • 2021-07-30
    140 min

    [RBK-020]Asking For A Girl At A Dating Club And A Usually Serious And Quiet Girl Who Is A New University Graduate Arrives So I Give Her A Good Fucking. Natsu Tojo

  • natsu tojo censoredbeautiful girlsingle workRBKattackersjo styleryuu bakuRBK-020RBK020rbk00020
    • 2021-08-06
    96 min

    [393OTIM-085]【妄想主観】痴女美少女と濃厚性交 水卜麻衣奈

  • amateur censoredcreampieamateurotimotim-085otim085393otim-085
    • 2021-09-11
    138 min

    [CEMD-055]Girls Who Experience Pleasure When They Bully Boys Truly Exist! Hikari Sena The Sensual Truth About A Perverted Girl Who Smiles With Pleasure When She Sees A Man Trying To Withstand Agony

  • hikari sena censoredmature womanslutCEMDserebu no tomoCEMD-055CEMD055cemd00055
    • 2021-09-19
    89 min

    [otat-007]みかこちゃん(26)

  • amateur censoredcreampiebig titsotatotat-007otat007otat-007
    • 2021-10-01
    120 min

    [HZGD-200]Can"t Turn This Married Woman Down. A Genuine Wife Brings On A Part-timer To Satisfy Her With A Risky Creampie. Nonoka Nogi

  • is it nogi censoredcreampiesingle workHZGDhitodzuma hanazono gekijouoosaki hirokoujiHZGD-200HZGD200h-1100hzgd00200
    • 2021-10-03
    93 min

    345SIMM-668 [Beautiful Girl With Sensual Nice Ass J ○] Arisu-Chan, An Active School Girl Who Is Dating An Uncle Of An Erotic Doujin Writer, Masturbates Her New Work Drawn By Her Uncle To A Side Dish. Daughter! I Rounded Up My Date Early Today And Wen

  • amateur censoredcreampieuniformsimmsimm-668simm668345simm-668
    • 2021-10-06
    120 min

    [GVH-300]The New Neighborhood Whore Wife Next Door Always Wears A Slutty Smile, But Never A Bra Or Panties! Azusa Tani

  • azusa tani censoredslutsingle workGVHglory questkisakura kabinGVH-300GVH300gvh00300
    • 2021-10-19
    32 min

    275OCHA-098 Aika

  • amateur censoredcreampieschoolgirlochaocha-098ocha098275ocha-098
    • 2021-10-21
    120 min

    [ARSO-21151]My Wife -Celeb Club- 151

  • rika matsuyama yoshino matsumiya censoredARSOaroundkiiroi hyouARSO-21151ARSO21151h-1378arso21151
    • 2021-10-22
    180 min

    [HUNBL-066]Step Mother Held For Her Son" Sake

  • censoredcreampieHUNBLhuntergeminihhh groupHUNBL-066HUNBL066hunbl00066
    • 2021-10-29
    139 min

    [MMND-202]"Excessive Filming" Nanami Ogura A 19-Year Old Innocent Babe With F-Cup Tits And A Voluptuous Body A Sakamichi-Style, Pure And Beautiful Girl

  • nanami ogura censoredbeautiful girlsingle workMMNDmimaniwasawa yukiMMND-202MMND202mmnd00202
    • 2021-10-30
    177 min

    [SORA-343]Exposing Submissive Miss Saseko. Hikari Chan (20 Years Old)

  • censoredcreampiebig titsSORAyama to sorahimurokkuSORA-343SORA343sora00343
    • 2021-11-02
    41 min

    FC2PPV 2398527 * Limited Quantity [Gachinanpa] [Appearance] A Woman Caught In A Village. I Put All The Moza On Her Face, So I Believe In The Words And Appear! !! I’ve Been Slamming With Raw Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-11-06
    31 min

    FC2PPV 2407412 【God! Healing Fetish W Beach 〇 Wave Very Similar Love Guy] I Am Tired And Faint In Agony With A Blowjob With Massage! Cute ~ Boobs Fucking And Ball Massage God Blow In The Mouth!

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored