jav over hours big tits cowgirl javcensored




FC2PPPDKSBJLULUHMNAMBIADNJUFEROYDMARAAVSADASDCAWDPREDGMEMSSISAUKGAPODVENUDTTCJOD

2020-09-26
47 min

[HHKL-067]"I Gotta Peel Back And Wash Your Penis Skin Properly!" My Much Older Step Sister Always Treats Me Like A C***d, And She Tries To Peel Back My Foreskin And Clean It Properly! Glamorous Big Tits Older Step Sister

  • censoredbig titshandjobHHKLhuntermorikihhh groupHHKL-067HHKL067hhkl00067
    • 2020-09-29
    95 min

    [ZOZO-013]The New Female Teacher At An All Boys' School Has Her Body Turned Into A Practical Demonstration - Ms Yui Kawai Edition

  • censoredbig titsZOZOsadistic villageZOZO-013ZOZO0131zozo00013
    • 2020-10-08
    161 min

    [MIST-316]Anal Hell - This Sadistic Bitch Is Sitting On My Face With Her B******y Big Ass And Creampie Fucking Me Until My Cock Is Swelling In Pain - Miki Yamase

  • miki yamase censoredcreampiesingle workMISTmr michirumiyoshi rusherMIST-316MIST3161mist00316
    • 2020-10-08
    47 min

    [gerk-312]つかさ

  • amateur censoredcreampieamateurgerkgerk-312gerk312gerk-312
    • 2020-11-19
    120 min

    [JYMA-004]She's Got Her Husband's Permission To Star In Porn! Raging Nympho Bride Offers Up Her Anal Hole To Other Guys To Enjoy - Her Big Tits Filmed With A Fish Eye Lens Just To Get Them All In

  • censoredcreampiebig titsJYMAjukujo ha tsurai yobuddha dmanji groupJYMA-004JYMA004jyma00004
    • 2020-11-27
    117 min

    [PED-003]When These Two Are Left Alone Together For 6 Hours... They Bang 9 Times. Hono Wakamiya

  • honoka wakamiya censoredbig titssingle workPEDdream ticketkurumi ichinosePED-003PED00324ped00003
    • 2020-12-10
    58 min

    230OREC-649 NaNami

  • amateur censoredcreampieschoolgirlorecorec-649orec649orec-649
    • 2020-12-13
    95 min

    [NSPS-950]My Wife Got G*******ged 12 - The Baby In Her Belly's Probably Not Mine... Ayane Yuki

  • ayane yuki censoredmature womansingle workNSPSnagae stylenagaeNSPS-950NSPS950nsps00950
    • 2020-12-21
    120 min

    [KSAT-027]A Personal Documentary! A Big Tits Wife Engages In Bodily Fluid-Secreting Aphrodisiac-Laced Mind-Blowing Sex Mayumi 30 Years Old

  • censoredcreampiebig titsKSATstrong woman s table daydream tribesix mantable of a strong womanKSAT-027KSAT027ksat00027
    • 2020-12-21
    45 min

    [ZOZO-027]Wan Horikita

  • horikita wa censoredZOZOsadistic villageZOZO-027ZOZO0271zozo00027
    • 2020-12-25
    106 min

    [YSN-535]My Stepdaughter Came Home For A Family Visit, And She Discovered My Sex Toys, But Instead Of Showing Contempt For My Lonely Ass, She Expressed Kindness And Tenderness Towards Me, And That Part Was All Good, But Then She Gave My Cock Some Soo

  • mitsuha higuchi yuki hiraoka censoredblowjobYSNnonYSN-535YSN535h-127ysn00535
    • 2021-01-01
    43 min

    FC2PPV 1628344 [Individual shooting] Lorimuchi J system of the brass band and the whip thighs are erotic and excited raw Paco cum shot in the round light and prickets

  • amateur uncensoredfc2
    • 2021-01-03
    77 min

    200GANA-2419 Seriously Nampa, first shot. 1578 A busty beautiful girl who came to see her boyfriend who is in love for a long distance from Kagoshima all the way, found in Shinjuku! Bring the boyfriend to the hotel where he is in trouble because he l

  • amateur censoredbig titssquirtingganagana-2419gana2419200gana-2419
    • 2021-01-16
    34 min

    [HHKL-080]Usually, I Never Have Any Sexual Feelings Towards My Little Stepsister, But When I Saw Her For The First Time In Her Team Uniform, Her Bulging Ass Was Just Too Sexy For Me To Resist! Karen Otoha

  • karen otoha censoredbig titssisterHHKLhunterkonjac kanohhh groupHHKL-080HHKL080hhkl00080
    • 2021-01-17
    151 min

    [CHCH-003]Due To Corona This Brothel Babe Is Running A Soapland Right Out Of Her Own Home! - Voluptuous Curves, Incredible Sex SK**ls, And Comfortable, Caring Services Make Her The Talk Of The Town -

  • censoredbig titsamateurCHCHmilk and moms emmanuellemilk and momsCHCH-003CHCH003chch00003
    • 2021-01-21
    62 min

    Pacopacomama 012121_424 Ayane Yuuki

  • ayane yuuki uncensoredcreampiebig titspacopacomama
    • 2021-01-23
    140 min

    [CAWD-167]"Nipples Or Nothing!" Nipples Teased With Tongue Until It Drives Your Cock Crazy - Dual Naughty Sluts Take Your Nipples For A Tantalizing Ride For 11 Loads Mitsuha Higuchi Karen Otoha

  • mitsuha higuchi karen otoha censoredcreampieslutCAWDkawaiitiger kosakaiCAWD-167CAWD167cawd00167
    • 2021-01-25
    59 min

    Pacopacomama 012621_426 Mirei Matsuoka

  • amateur uncensoredpacopacomama
    • 2021-01-26
    124 min

    [SCPX-416]The Beautiful Girl Next Door Had A Fight With Her Boyfriend And Stormed Out Of The House In Her Underclothes. "It's Cold, Why Don't You Come In？" I Told Her, And Invited Her Into My Room, But When I Saw Her So Defenseless, W

  • censoredcreampiebig titsSCPXk m producehasshiscoop kmpSCPX-416SCPX416h-565scpx00416
    • 2021-01-29
    237 min

    [OKAX-698]Home Invasion: Married Woman Gets Ravished 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-698OKAX69884okax00698
    • 2021-02-06
    117 min

    [SSNI-987]I Spent My Summer Bored Out In The Country So I Took A Ride On The Hot Local MILF To Breed My Days Away Tsukasa Aoi

  • tsukasa aoi censoredbig titssingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-987SSNI987ssni00987
    • 2021-02-09
    480 min

    [KTRA-277]Beautiful Girls With Shaved Pussies 10 Girls Fucked 8 Hours 2-Disc-Set

  • atomi shuri asahi maple censoredbig titsbeautiful girlKTRAk tribeKTRA-277KTRA277h-094ktra00277
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    93 min

    [OKP-077]Divine Pantyhose Nagi Mamiya We're Bringing You A Lolita Beautiful Girl In A School Uniform With Beautiful Legs Wrapped In Naughty And Nasty Pantyhose For Fully Clothed Musty Sniffing Pleasure, From Her Soles To Her Toes! Enjoy Masturbat

  • mamiya nagi censoredsingle workbukkakeOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-077OKP0771okp00077
    • 2021-02-16
    137 min

    [STARS-328]I'm A Married Man, But While On A Business Trip, I Met This Outgoing Local Beauty At A Local Snack Bar, And Spent 2 Nights Fucking Her Brains Out At A Hot Spring Resort Mei Miyajima

  • mei miyajima censoredbeautiful girlsingle workSTARSsod createbacon tanakasod starSTARS-328STARS3281stars00328
    • 2021-02-19
    37 min

    359TYVM-131 Muscular beauty body young wife rich dense creampie sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-131tyvm131359tyvm-131
    • 2021-02-25
    67 min

    OMNK-003 Rina

  • amateur censoredbig titsamateuromnkomnk-003omnk003omnk-003
    • 2021-02-26
    59 min

    FC2PPV 1697114 [Personal shooting] Nanase 24 years old, mass firing on shaved nice ass slender black gal with outstanding sensitivity

  • amateur uncensoredfc2
    • 2021-03-11
    45 min

    [TOTTE-015]Pull It Out And Take A Picture! Magic Mirror Number

  • censoredcreampiesquirtingTOTTEsadistic village nowphotos leaked magic mirror cab sadistiTOTTE-015TOTTE0151totte00015
    • 2021-04-08
    74 min

    [230OREC-736]ひな

  • amateur censoredcreampieuniformorecorec-736orec736230orec-736
    • 2021-04-15
    149 min

    [KTKZ-085]Good Girl With Colossal Tits - Waka *No Mercy *But She Still Doesn't Get Mad So We Felt A Little Bad About It - And Horny

  • censoredbig titsamateurKTKZkitixx mousouzokukinzo tamamishinjinKTKZ-085KTKZ085ktkz00085
    • 2021-05-01
    63 min

    SIRO-4505 [First shot] [Innocent girl] [Natural H cup daughter] A shy and pure active college student participates in the war. While she was listening to the story, she was attracted to her charm and took off her cute clothes .. AV application on the

  • amateur censoredbig titsamateursirosiro-4505siro4505siro-4505
    • 2021-05-01
    64 min

    324SRTD-0224 I Can’t Stand It Should Be Just An AV Interview And Insert A Runaway Student!

  • amateur censoredbig titsamateursrtdsrtd-0224srtd0224324srtd-0224
    • 2021-05-11
    61 min

    HEYZO 2528 Beautiful Girl’s After School Life No.36 -Enjoying A Girl’s Body In Short Skirt- – Kurumi Tokito

  • kurumi tokito uncensoredcreampieheyzo
    • 2021-05-21
    34 min

    359TYVM-158 Pinch and eat the entry / exit trader! Creampie sex with a squirting wife who works at a famous department store! !!

  • amateur censoredcreampiemarried womantyvmtyvm-158tyvm158359tyvm-158
    • 2021-05-22
    241 min

    [OKAX-738]Filthy Massage Parlor Where Beautiful Older Women Shake Their Hips And Cum 240 Minutes

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-738OKAX738okax00738
    • 2021-06-15
    54 min

    491TKWA-005 Minami 2

  • amateur censoredcreampieamateurtkwatkwa-005tkwa005491tkwa-005
    • 2021-06-20
    120 min

    [SRMC-033]Hypno-drama: A Wife With A Big Ass Drowning In Influenced Pleasure - Yurika Aoi

  • yurika censoredsquirtingsingle workSRMCh m rashmiyoshi rusherSRMC-033SRMC033srmc00033
    • 2021-06-22
    145 min

    [SDMM-093]Magic Mirror Number Barely legal countryside S*****ts are on a school trip to Tokyo. Taking part in a very special class on health and physical education, they allow a hard dick to slide into their super tight and narrow pussies! The virgin

  • censoredschoolgirlSDMMsod createanzomirror noSDMM-093SDMM0931sdmm00093
    • 2021-07-09
    110 min

    300NTK-601 Drunk 4P! !! The W cowgirl where the slender beauty body of a new graduate OL who is too beautiful dances warped is a masterpiece! !! With the finest technique that does not seem to be a newcomer, insert the Gachibokki boss Ji ○ into the o

  • amateur censoredcreampieamateurntkntk-601ntk601300ntk-601
    • 2021-08-14
    50 min

    404DBL-0085 A Simple Erotic Mature Woman Who Is Taken And Burns! Maki 32 Years Old

  • amateur censoredamateurslutdbldbl-0085dbl0085404dbl-0085
    • 2021-09-18
    89 min

    [BJD-044]60th Birthday Full Moon Mature Mating Trip to Kinugawa Hot Springs Ruriko Kanda

  • ruriko kanda censoredmature womansingle workBJDrubykatsumoku saburoubojouBJD-044BJD044bjd00044
    • 2021-10-08
    46 min

    SKHO-008 Minami (Minami Hironaka)

  • amateur censoredcreampieamateurskhoskho-008skho008skho-008
    • 2021-10-15
    146 min

    [MUDR-166]It"s After School. This Girl Looked Like A Pushover, So We Took Her, And Surrounded Her With A Ring Of Dirty Old Men, And Soiled Her With Bukkake, Relentlessly, Over And Over And Over Again ... Hikaru Minazuki

  • hikaru minazuki censoredblowjobsingle workMUDRmukuMUDR-166MUDR166mudr00166
    • 2021-10-23
    135 min

    [AGAV-064]Best Masochism In Yokohama -Super Masochist Man"s Nipples Teased In Edging Cum Control Spider Cowgirl-

  • mio mashiro censoredbeautiful girlslutAGAVsex agentyoshida daibutsuAGAV-064AGAV064agav00064
    • 2021-11-16
    44 min

    481SACZ-096 Chiharu 2

  • amateur censoredamateurbdsmsaczsacz-096sacz096481sacz-096
    • 2021-12-17
    165 min

    [MUKC-019]A Cute Underground Idol Who Makes Men Fall In Love With Her, A Secret Off-package Pillow Fight, Creampie OK, Cosplay Sex, Cum Crazy 6 Times, Nanami Yokomiya

  • yokomiya nanami censoredcreampiecosplayMUKCmukuinnocent cosplayMUKC-019MUKC019mukc00019
    • 2021-12-24
    68 min

    OREX-330 Fuwari-chan 2 (Hino Fuwari)

  • amateur censoredcreampiebig titsorexorex-330orex330orex-330
    • 2022-01-05
    41 min

    FC2PPV 2571466 [Personal Shooting] A Full-Time Mature Woman Housewife Who Is Tired Of Everyday Life "I Want More And More Ji Po …"

  • amateur uncensoredfc2
    • 2022-01-14
    74 min

    [HEYZO-2718]mizuno pearents Myu Loli Wife Got Swapping Orgy With Breastmilk Shower -Mr. and Mrs. Mizuno & Myu-

  • amateur uncensoredheyzo
    • 2022-01-24
    51 min

    292MY-504 Saori Kitagawa 2

  • amateur censoredmarried womanamateurmymy-504my504292my-504
    • 2022-01-26
    337 min

    [SCBB-001]001# Picking Up Girls At Random In Tokyo/Amateur CLOVER Complete Best!

  • censoredamateurSCBBamateur cloverdarts picking up girls in tokyoSCBB-001SCBB001h-1616scbb00001
    • 2022-01-28
    129 min

    [ATID-499]A Girl In The Neighborhood Who Had Said She Was Going To Marry An Old Man Got Married. I Couldn"t Forgive Her For Betraying Me, So I Locked Her Up And Press-trained Her Until She Got Pregnant. Yui Amane

  • amane yui censoredcreampiebeautiful girlATIDattackersjo stylein madATID-499ATID499atid00499
    • 2022-02-05
    233 min

    [ZMAR-057]Totally! Sana Matsunaga

  • sana matsunaga censoredcreampiebig titsZMARplanet plusmaruttoZMAR-057ZMAR057h-237zmar00057
    • 2022-02-07
    300 min

    [258DKSB-138]素人なのにエロくて上手すぎるフェラチオ BEST OF BESTコレクション 29連発 5時間

  • amateur censoredamateurdksbdksb-138dksb138258dksb-138
    • 2022-02-15
    122 min

    [ZEX-412]A Moment Of Bliss - Wonderful Lesbian Sex With Two Women Whom She Likes Very Much -

  • sarina momonaga otsuki sound censoredlesbianZEXpeters maxZEX-412ZEX412h-720zex00412



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored