jav planning high vision amateur creampie




FC2BBANAWDCJODROYDMEYDSSNICESDSHKDDTTDASDMIAAMVSDAPODNACREBODMIDVAMBICHRVVENXFSDSS

2021-01-16
58 min

Caribbeancom 011621-001 Creampie SEX with Fcup gorgeous body girl Riri Shiraki

  • riri shiraki uncensoredcreampiecaribbeancom
    • 2021-01-29
    76 min

    [ssan-015]まおさん

  • amateur censoredbig titsamateurssanssan-015ssan015ssan-015
    • 2021-01-30
    254 min

    [HZMEN-007]Getting Turned On By Seeing A Cabin Attendant In Pantyhose In An Unguarded State For The First Time! The Shape Of Her Beautiful Legs Is Too Hot So I Splattered Hot Stuff All Over Them Without Waiting For Permission To Land!! 9 Girls Gettin

  • nanako miyamura natsuho imai censoredHZMENz menkoenji goroHZMEN-007HZMEN007h-1371hzmen00007
    • 2021-02-06
    120 min

    [GS-2005]True Stories Stories Of Shame Special Extra Edition (40) What Happened Afterwards...

  • censoredGSgosGS-2005GS2005h-101gs02005
    • 2021-02-09
    60 min

    FC2PPV 1679338 ★ First shot amateur ☆ Active JD’s big pie Pochakawa ♥ Ringo-chan 20 years old ☆ G cup huge breasts erotic girl ♥ Super erotic rich blowjob ♥ The best pussy ever! Tokuno Creampie ♥ [Personal shooting] * With benefits

  • amateur uncensoredfc2
    • 2021-02-11
    118 min

    [FSDSS-168]The Sexual Instructions Of A Teacher Who Devours Her S*****ts Cocks With The Passion Of A Virgin - Suzume Mino

  • suzume mino censoredbig titsslutFSDSSfalenoyamaguchi memberfaleno starFSDSS-168FSDSS1681fsdss00168
    • 2021-02-18
    102 min

    [KEED-065]My Girlfriend's Mom Seduced Me With Her Naughty Lingerie And Promises Of Creampie Sex Nao Takizawa

  • nao takizawa censoredcreampiemarried womanKEEDcenter villagejiro fukagawahanazono center villageKEED-065KEED065h-086keed00065
    • 2021-02-19
    131 min

    [ONSG-032]Big Titted Prostitute - Rui Miura

  • rui miura censoredcreampiebig titsONSGgain corporationONSG-032ONSG032onsg00032
    • 2021-02-27
    170 min

    [GAID-017]"Teacher, Please... Don't Just Look At My Tits"

  • censoredcreampiebig titsGAIDfirst staraida first starGAID-017GAID017h-491gaid00017
    • 2021-03-27
    56 min

    491TKWA-062 A comedian’s daughter, a female college student who resembles Oka ○ Yui ○, and a love-love stay! Allow vaginal cum shot to the pussy stirred by the raw chin of a ugly man!

  • amateur censoredcreampieamateurtkwatkwa-062tkwa062491tkwa-062
    • 2021-05-01
    115 min

    [JUL-559]Exclusive Honoka Yonekura Is Getting Sweaty And Seriously Non-Stop Cumming!! Hard And Tight Sex - A Manly Housekeeper Consoles A Woman Mourning Her Failing Marriage With At-Home Adultery Sex -

  • hoika yonekura censoredmature womansingle workJULmadonnarokusaburo mishimaJUL-559JUL559jul00559
    • 2021-05-10
    99 min

    300MIUM-707 Big Cock 100 Slashing Big Butt Wife! !! !! [Dirty wife caught for big dick] → Ji ● If you ask me to get up, [Shake the big cock and show off a thick dildo masturbation! ] Gingin erection Chi ● Sucking on Po! !! Raw insertion from drooling

  • amateur censoredcreampiemarried womanmiummium-707mium707300mium-707
    • 2021-05-14
    48 min

    285ENDX-344 Big Tits, Fair-skinned and Good Head! What’s more, I love SEX and I’m not satisfied with it even though I’ve been doing it many times!

  • amateur censoredcreampiebig titsendxendx-344endx344285endx-344
    • 2021-05-15
    121 min

    [SUJI-134]Breaking In A Pretty Y********l Barely Legals Love Getting Fucked By Persistent Older Men

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-134SUJI134suji00134
    • 2021-06-04
    166 min

    [HUNBL-048]"Hey Big Sis, I Hope You Realize What's Happening ..." Every Time He Goes Over To His Girlfriend's House, This Piece Of Shit Commits Unspeakable Acts Upon Her Plain Jane And Meek Little Sister

  • censoredcreampieschoolgirlHUNBLhunteraldebaranhhh groupHUNBL-048HUNBL048hunbl00048
    • 2021-06-05
    220 min

    [DSD-827]BLACK x BLACK Kings With Huge Cocks And Beautiful Black Women

  • tina trum skin diamond censoredblowjobDSDmomotaro video publishinglexington steelesweetdevilDSD-827DSD827dsd00827
    • 2021-06-09
    79 min

    522DHT-259 [The abomination of the wife who sheds tears and accepts Irama! ] Suck with a slump! Stick your cheeks from the side and expose your face! The vibe is inserted and removed by yourself and the lewd juice spouts many times! "It’s th

  • amateur censoredcreampiebig titsdhtdht-259dht259522dht-259
    • 2021-06-19
    118 min

    [JUL-619]When I Went Back To My Hometown I Found Out The Girl I Used To Like Is Now A Married Woman. Our Passionate Tryst Caught On Camera. Asahi Mizuno

  • mizuno chaoyang censoredcreampiebig titsJULmadonnakitorune kawaguchiJUL-619JUL619jul00619
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    107 min

    [APKH-177]The Ultimate Amateur？ Naughty Hot Spring Soapland Brothel Babe - Real Life College Girl Makes For The Most Incredible Bubble Princess - Semen-Slurping POV Footage Ayumi Manaka

  • ayumi aika censoredcreampiesingle workAPKHaurora project annexhaurora project anexAPKH-177APKH177apkh00177
    • 2021-07-06
    134 min

    [STARS-392]Yuna-san Is A Popular, Erotic And Cute Beautician Who Is Actually An Unbelievable Kissing Fiend She'll Lure Her Customers To Slobbering And Kissing Temptation Yuna Ogura

  • yuna ogura censoredcreampieslutSTARSsod createchinpo dazaisod starSTARS-392STARS3921stars00392
    • 2021-07-13
    104 min

    261ARA-497 [Geki Kawa Otaku Musume] [Sweet voice of charm] Tsumugi-chan is here! The reason for her application is "I read a naughty douujinshi and got horny ♪" The book is thin, but I’m hot w [Moe body] I was squeezed and cummed and Iki

  • amateur censoredamateuraraara-497ara497261ara-497
    • 2021-07-24
    106 min

    300NTK-610 [Summer Big Tits Gal Assortment! !! Outdoor 6p Big Orgy Sp Of All G Over De Nasty Gal X 3! !! ] Exactly Sake Pond Meat Forest! !! Gal From The Right! !! Gal! !! Gal! !! Yes Heaven For All G Milk And Above! !! It’S Okay To Touch With T

  • amateur censoredcreampiebig titsntkntk-610ntk610300ntk-610
    • 2021-08-08
    14 min

    10musume 080821_01 I’Ll Make You Feel Good By My Mouth, So I Hope This Might Cheer You Up？ Yu Nagata

  • amateur uncensored10musume
    • 2021-08-13
    121 min

    [PPPD-955]Spence Breast Development Clinic Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsPPPDoppaiPPPD-955PPPD955pppd00955
    • 2021-08-14
    133 min

    [LZDM-044]Through An Amazing Technique, A Straight Girl With Big Tits Comes Like Crazy When She Descends Into Lesbian Play At A Pussy Beauty Clinic. Ruka Inaba, Nanako Miyamura.

  • inaba nanako miyamura censoredbig titssquirtingLZDMlez reryo gokulez re dramaLZDM-044LZDM044lzdm00044
    • 2021-08-14
    133 min

    [SOAN-064]Ticking Time Bomb Anal Sex "So Cute, It"s Sick ..." My Favorite Style Is Sick ... I Love Anal Sex So Much I"m Losing My Mind (We"re Flying In Rare Air Here) Honoka Shiina

  • shiina honoka censoredanalsingle workSOANyama to soratanizoko fu taroukoumon houmonSOAN-064SOAN064soan00064
    • 2021-08-17
    151 min

    [SDAB-194]The Famous Girl From The Bathhouse That Helps You Wash Your Back And Deal With Your Sex Drive.

  • sakita ran takayama suzu censoredsquirtingbeautiful girlSDABsod createdazai chinposeishun jidaiSDAB-194SDAB194
    • 2021-08-31
    54 min

    H4610 ki210831 Nanako Sugizaki 19years old

  • amateur uncensoredh4610
    • 2021-09-03
    179 min

    [MIFD-176]Newcomer, 19 And Half, Y********l. She Wants To Be An Adult. JAV DEBUT Kazuna Yuuki

  • kazuna yuki censoredbeautiful girlsingle workMIFDmoodyzusapyonmoodyz freshMIFD-176MIFD176mifd00176
    • 2021-09-10
    173 min

    [DASD-915]The Bitch"s Vulgar Fucking With Overly Gross Licking And Sucking. Akari Mitani

  • mitani akari censoredcreampieblowjobDASDdasnao masakiDASD-915DASD915dasd00915
    • 2021-09-24
    125 min

    [ZKWD-018]The After-School Human Toilet #18 Aya Sakai

  • ayami sakai censoredcreampiesingle workZKWDtoyohikozarakiyasushiun kaiZKWD-018ZKWD018zkwd00018
    • 2021-09-24
    240 min

    [REXD-385]That Woman... She Made Such A Fool Of Me... I Want To Take Revenge... For What She Did To Me...

  • censoredcreampieREXDredgroupREXD-385REXD385rexd00385
    • 2021-09-25
    55 min

    521MGFX-025 Excavation ☆ Big Breasts Amateur 20

  • amateur censoredbig titsamateurmgfxmgfx-025mgfx025521mgfx-025
    • 2021-09-30
    122 min

    [AARM-020]She Kept Acting Like She Wanted Some Cock Shoved Into Her Pussy, But In The End, All She Did Was Show Off Her Cunt And Ejaculated Me With A Foot Job, Because She"s Such A Dick Tease

  • misaki azusa tsubaki rika censoredblowjobslutAARMaroma kikakuhamu oujiaromaAARM-020AARM020aarm00020
    • 2021-10-09
    30 min

    FC2PPV 2320880 [Appearance] A Large Amount Of Vaginal Cum Shot In Her Womb In Search Of Pleasure … In Translation, I Met A Beautiful Woman At A Beer Hall Off Party. * Sale Period, Limited Number Of Pieces, Half Price. Deleted Immediately When Th

  • amateur uncensoredfc2
    • 2021-10-09
    135 min

    [REAL-779]20 Loads in a Row Creampie Sex for the Pregnancy Fetish of a S********l

  • yui nagase censoredcreampieschoolgirlREALk m producegory matsudareal real worksREAL-779REAL779real00779
    • 2021-10-14
    76 min

    533NNS-013 Underground Idol P Live Outflow Video! !! Masturbation Addicted Plump Nice Ass, Fair-Skinned Beauty Big Tits Soft Body Beautiful Girl Gachi Died! !!

  • amateur censoredcreampieamateurnnsnns-013nns013533nns-013
    • 2021-10-29
    115 min

    [NNPJ-480]"Hurry, Let"s Go To A Hotel..." On A Dating App! Fucking Right Away! Sexy Beautiful Married Woman Was In A Hurry To Fuck. Came 6 Times In 2 Hours FUCK! Limited Time Affair With A Married Woman: Mrs. Akari

  • censoredcreampiebig titsNNPJnampa japanNNPJ-480NNPJ480nnpj00480
    • 2021-11-11
    112 min

    [SPRD-1479]Since that Day When I Slept Next to My Stepmom... Mirei Fujisaki

  • misaki fujisaki censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1479SPRD147918sprd01479
    • 2021-12-02
    90 min

    [REBD-606]Tsubasa 2: Eternal Wings * Tsubasa Amami

  • amami tsubasa censoredsingle workREBDrebeccazack araiREBD-606REBD606h-346rebd00606
    • 2021-12-03
    120 min

    [WAAA-124]Hated Boss Enjoys Harassing Big Tits For The Perfect Scenario... Sensitive Masochism With A Busty Woman That Cums Too Easily. I"m Getting Trained And Groped While Fucked For A Creampie Load. JULIA

  • julia censoredcreampiebig titsWAAAwanz factoryWAAA-124WAAA124waaa00124
    • 2021-12-17
    62 min

    230OREC-959 Rurika (Misato Rurika)

  • amateur censoredcreampieamateurorecorec-959orec959230orec-959
    • 2021-12-24
    165 min

    [SSIS-278]Mai Shiomi And Her M-man Virginity Are Alone For 24 Hours! No NG! Unlimited Firing! This Is A Document Of Overkill Brush-off!

  • mai shiomi censoredblowjobbeautiful girlSSISs1 no 1 styleichigoharaSSIS-278SSIS278ssis00278
    • 2021-12-24
    52 min

    [WKD-049]Fallen Woman - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredslutsingle workWKDwaap entertainmentk westwWKD-049WKD0492wkd00049
    • 2021-12-28
    122 min

    [SAN-032]The Life Of A Woman Who Became Complicit In Her Husband"s Plans, Lost Everything, Took Revenge And Took Her Own Life.

  • nagaoka censoredcreampiesingle workSANmazaisland watakanomother mazaSAN-032SAN032h-796san00032
    • 2022-01-13
    121 min

    [NTRD-097]Cuckolders Series: With My Subordinate？ No Way... Satomi Nagasawa.

  • satomi nagasawa censoredmature womansingle workNTRDtakara eizokouji takarashintokaiNTRD-097NTRD09718ntrd00097
    • 2022-01-21
    93 min

    [529STCV-058]【 性欲旺盛週7オナニストin 大山】欲求不満なオナニー大好きデカ尻美女と一緒に大人のおもちゃレビュー♪新品ローター

  • amateur censoredcreampieamateurstcvstcv-058stcv058529stcv-058
    • 2022-01-22
    239 min

    [MCSR-469]Specializing In Masturbation! Blowjob Action! Handjob Action! Nipple Tweaking! 16 Divine Massage Parlor Therapists Who Will Guide You To Your Most Pleasant Ejaculation Ever! All Ladies Are Married Woman Babes!

  • censoredblowjobhandjobMCSRbig morkalguo masumascottMCSR-469MCSR46957mcsr00469
    • 2022-01-27
    41 min

    477GRMR-063 Neighbor Is A Horny Older Sister-A Horny Beauty Who Makes An Obscene Voice Every Day And Mutual Masturbation Through The Wall …？ !! ~

  • amateur censoredbig titsamateurgrmrgrmr-063grmr063477grmr-063
    • 2022-02-05
    142 min

    [GMEM-057]Confinement! Agony! Screaming! Ecstasy! New Elite Recruit Of The Narcotics Investigation Squad Attempts Infiltration, And Winds Up In A Salacious Situation Starring Tsumugi Narita

  • narita tsumugi censoredsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-057GMEM057gmem00057
    • 2022-02-17
    64 min

    C0930 ki220217 Shinobu Kawahara 28years old

  • amateur uncensoredc0930
    • 2022-02-19
    243 min

    [NASH-646]I Can"t Wait Until Tonight! 50-something Stepmoms Who Are Prey To Their Stepsons From Dawn Till Dusk BEST 4 Hours 3

  • censoredcreampiemature womanNASHnadeshikoNASH-646NASH646nash00646
    • 2022-02-24
    15 min

    [HEYZO-2728]Manami Ueno Manami"s Amazing Hand Job

  • manami ueno uncensoredhandjobheyzo
    • 2022-02-26
    143 min

    [JKSR-530](Leaked Pictures) A Sch**lgirl Club Training Camp Fuck Fest 7 Consensual Sex / Night Visit / Threesome Fuck Fest / Bath / Peeping While Changing ... And Other Immoral Videos

  • censoredschoolgirlamateurJKSRbig morkalobockeyprink junkyJKSR-530JKSR53057jksr00530
    • 2022-03-03
    177 min

    [SHIND-028]The Relentless Stalker On The Maso Train A Video Record Of A Home Invasion #54 55

  • censoredamateurSHINDshinkiromirage mirageSHIND-028SHIND028h-1560shind00028



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored