jav pov def amateur censored




FC2WAAAVENXGMEMONEZWANZAWDSHKDMIAASSISMIDESANGVHCHRVAPODNATRNACRRBDBLKSQTEHMN

2020-10-08
104 min

[SPRD-1333]Stepmom Fucked By Her Son-in-law - Yuka Yamagishi

  • yuka yamagishi censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1333SPRD133318sprd01333
    • 2020-10-09
    120 min

    [MDTM-676]New After School Beautiful Girl, Rejuvenation Reflexology + Vol. 037 Urara Hanane

  • hanaoto urara censoredcreampieblowjobMDTMuchu kikakutodoMDTM-676MDTM676h-585mdtm00676
    • 2020-10-13
    108 min

    SMUK-029 Kurumi

  • amateur censoredschoolgirlamateursmuksmuk-029smuk029smuk-029
    • 2020-10-20
    67 min

    299EWDX-324 Rei 26 years old Fair-skinned cool beauty G milk wife with outstanding style

  • amateur censoredbig titsmarried womanewdxewdx-324ewdx324299ewdx-324
    • 2020-10-23
    73 min

    [HYPN-032]The Day I First Brainwashed Somebody - Fuckable Wife Turned Into A Mindless Sex Doll Miku Abeno

  • miku abe censoredcreampiemarried womanHYPNsod createsatoshi morikawamind controlHYPN-032HYPN0321hypn00032
    • 2020-10-24
    152 min

    [HND-894]Slim Female Manager Of A Soccer Club - Tiny Titty College Girl Strips Down To Take A Creampie On Her Porn Debut! Wan Horikita

  • horikita wan censoredcreampiesingle workHNDhon nakausa pyonHND-894HND894hnd00894
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-05
    485 min

    [ABBA-495]Monthly Center Village Survey Bonus Edition 2020's Highest Ranked MILFs - Greatest Hits - 30 Mature Girls, 8 Hours, 2 Discs

  • censoredcreampiemature womanABBAcenter villageABBA-495ABBA495h-086abba00495
    • 2020-11-26
    182 min

    [SW-740]I Bet You Wanna Fuck A S********l, Right？ Sweet Temptation! So What If The Teen Next Door Tried To Seduce You, Just Like In All Of Your Fantasies？ Real Men Don't Let Golden Opportunities Like This Go To Waste!

  • censoredSWswitchswitch switchSW-740SW7401sw00740
    • 2020-11-30
    112 min

    [RD-1028]A Filthy Showa Sensual Drama This Fifty-Something Wife Works At A Silk Making Factory, And She Sacrificed Everything For Her Mother... This Poor Wife Settled Her Father's Debts By Putting Up Her Hairy Pussy For Sale...

  • natsuki fujioka aya natsume censoredmarried womanblowjobRDathena videomurayamaathenaRD-1028RD1028149rd01028
    • 2020-12-12
    150 min

    [DASD-775]Breaking In An Obedient Transsexual At Work. Riara Yumemi

  • dream dream censoredanalsingle workDASDdasrokusaburo mishimaDASD-775DASD775dasd00775
    • 2020-12-17
    117 min

    [JYMA-005]While Her Husband Was Away On Business, This Young Wife Invited Men Over To Satisfy Her Lust This Voluptuous Wife Loves Cock And Now She's Having Maso Slut Sex Her Colossal Tits And Ass Are Jiggling And Wiggling In Thrilling Fetishistic

  • censoredcreampiebig titsJYMAjukujo ha tsurai yobuddha dmanji groupJYMA-005JYMA005jyma00005
    • 2021-01-01
    79 min

    [MARAA-077]片山茉希 触れただけでビクンとしちゃう

  • katayama maki censoredsoloworkMARAAspice visualMARAA-077MARAA077
    • 2021-01-10
    141 min

    [BADA-010]Kinky, Wild, Sensitive Wife Can't Say No To Her Husband - He Has Her Fuck A Ton Of Guys She Doesn't Know Miya Tanaka

  • miya tanaka censoredcreampieblowjobBADAbaltanminimal iwamuradiamondBADA-010BADA010bada00010
    • 2021-01-21
    68 min

    FC2PPV 1653532 [Limited time offer] Cute female college student and raw squirrel who made their university debut! There is a second round [Personal shooting of support [No.45]] [Review privilege: Another angle]

  • amateur uncensoredfc2
    • 2021-02-04
    66 min

    [SIROR-048]The Work Of A Mature Woman For Rent - The Hidden Face Of A Wife, Unknown To Her Husband NO. 48 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-048SIROR048h-1492siror00048
    • 2021-02-06
    150 min

    [PRED-286]Now Ready For Her First Ever Creampie - 10-Load SPECIAL Kano Kashii

  • kashii hanano censoredcreampiesingle workPREDpremiumkyoseielegancePRED-286PRED286pred00286
    • 2021-02-13
    109 min

    240TOKYO-408 Yuuka

  • amateur censoredbig titsamateurtokyotokyo-408tokyo408240tokyo-408
    • 2021-03-05
    181 min

    [ABW-064]Female Manager Becomes Our Sex Toy 038 Konomi Nagisa

  • nagisa konomi censoredbig titssingle workABWprestigemichiru sunabsolutelyABW-064ABW064118abw00064
    • 2021-03-08
    52 min

    492MERC-243 The teacher has already quit … 2

  • amateur censoredbig titsuniformmercmerc-243merc243492merc-243
    • 2021-03-15
    480 min

    [PTS-477]Awakening At The Lesbian Massage Parlor! 12 x Married Sluts! 102 x Orgasms! 43 x Squirting! 8 Hours

  • yui hatano blue censoredmarried womanlesbianPTSpetersnanzaki masakiPTS-477PTS477h-021pts00477
    • 2021-03-19
    47 min

    [sika-060]通野ちゃん 2(27)

  • amateur censoredamateurblowjobsikasika-060sika060sika-060
    • 2021-04-03
    107 min

    [VEC-472]MILF Besties Nanami Matsumoto

  • nana matsumoto censoredcreampiebig titsVECvenussarumegami venusVEC-472VEC472vec00472
    • 2021-04-07
    135 min

    512EMST-001 Thin Miku

  • amateur censoredcreampiebig titsemstemst-001emst001512emst-001
    • 2021-04-12
    65 min

    SIRO-4446 [First shot] [Beautiful apparel clerk] [Careful smile of semen bettori] An apparel clerk with snow-white skin appears. She is an adult-like girl with a calm behavior, but when her sensitive parts are stimulated, she begins to writhe in a cu

  • amateur censoredamateursirosiro-4446siro4446siro-4446
    • 2021-04-22
    124 min

    [FSDSS-210]I Am A Slut Beautiful Y********l Makes Older Men Cum Over And Over Yui Shirasaka

  • yui shirasaka censoredblowjobbeautiful girlFSDSSfalenoboomer 44faleno starFSDSS-210FSDSS2101fsdss00210
    • 2021-04-23
    238 min

    [BMW-232]My Stepsister Seduced Me While Our Parents Weren't Paying Attention - Pulse-Pounding Creampie BEST Collection

  • mitani akari real village henan censoredcreampieblowjobBMWwanz factorywanzBMW-232BMW232bmw00232
    • 2021-05-01
    70 min

    [MBRAZ-029]川口彩夏 放課後、夕立…君と僕。

  • hanazawa himari censoredsoloworkMBRAZspice visualMBRAZ-029MBRAZ029
    • 2021-05-07
    152 min

    [IPX-666]"If You've Missed The Last Train Home, Why Don't You Come Over To My Place" My Girlfriend Was Waiting For Me At Home, But After I Missed The Last Train Home, I Decided To Spend The Night At My Female Colleague's Place ...

  • minami aizawa censoredblowjobslutIPXidea pocketkahori maedanodishIPX-666IPX666ipx00666
    • 2021-05-08
    157 min

    [DGCEMD-005]Delivery Only! Special Video Included Squirting All Over Each Other Is How Women Express Their Love Up Close Squirting Lesbians Mihina Hina Kanno

  • mihina azumihina mihina nagai jinno hina censoredsquirtinglesbianDGCEMDcelebrity friendsDGCEMD-005DGCEMD005dgcemd00005
    • 2021-05-15
    120 min

    [KSBJ-135]My Husband's Son Mistook Me For An Escort When We First Met And I Let Him Cum Inside Of Me Hibiki Otsuki

  • otsuki sound censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-135KSBJ135ksbj00135
    • 2021-05-21
    55 min

    FC2PPV 1829554 * Weekend limited 6000⇒3980pt ★ Inverted nipple transcendental beauty BODY’s super cute Aimi-chan 19 years old ☆ Systemic erogenous zone ♥ Sensitive bristle pussy rolls up ♥ Excitement MAX super squirrel mass cum shot that perfect

  • amateur uncensoredfc2
    • 2021-05-21
    153 min

    [CJOD-298]"Adultery Is Our Culture!" Slutty Adultery Tales About Thick Nympho Wives With Erect Nipples Having Wild And Steamy Raw Sex With Men They've Picked Up Chitose Yuki

  • chitose in the evening censoredcreampiebig titsCJODchijo heavenkanoa tojoCJOD-298CJOD298cjod00298
    • 2021-06-10
    124 min

    [FSDSS-235]Romantic Cohabitation Sex! French Kissing With Flirty Hot Girl Teacher Momo Honda

  • honda peach censoredsingle workFSDSSfalenoboomer 44faleno starFSDSS-235FSDSS2351fsdss00235
    • 2021-06-12
    120 min

    [GMA-020]Breaking In Wives With S&M - Naughty Father-In-Law Preys On Horny Married Woman - The Day They Can Never Come Back From, Irresistible Adulterous Pleasure... Ku Akane Fuji

  • akane kudo censoredmature womanbdsmGMAglobal media annexkaiGMA-020GMA020gma00020
    • 2021-07-10
    245 min

    [BAZE-003]Extra Help at Lunch Time, Secret from the Company Beautiful Office Lady Earns Money for SEX and 4 Hours of Creampies. 03

  • censoredcreampiebig titsBAZEbazookatetBAZE-003BAZE003baze00003
    • 2021-07-13
    60 min

    H4610 ki210713 Nanako Shirai 20years old

  • amateur uncensoredh4610
    • 2021-07-16
    65 min

    444KING-043 Sara

  • amateur censoredcreampiebig titskingking-043king043444king-043
    • 2021-07-17
    124 min

    [HMN-025]I Heard That My Girlfriend's Older Sister Was Going To Make Her Sex Club Debut, So ... My Girlfriend's Older Sister And Her Friend (Another Sex Worker) Called Me Out For A Reverse Threesome Pin-Down Creampie Attack And Used Me As Tar

  • riho fujimori tsujii honoka censoredcreampiebig titsHMNhon nakamiyoshi rusherHMN-025HMN025hmn00025
    • 2021-07-31
    132 min

    FC2PPV 1948352 I secretly removed the rubber on the way to a loli bristle slender with one experienced person and made a vaginal cum shot, a stunned expression. & 19-year-old G cup fair-skinned beautiful breasts JD is thrust at her first raw cock

  • amateur uncensoredfc2
    • 2021-08-01
    123 min

    [NACR-442]The Case Of My Father"s Young, Beautiful Second Wife Being A Horny Slut. Sumire Kurokawa

  • sumire kurokawa censoredcreampiemature womanNACRplanet plusdirector oshichi ku ryuuNACR-442NACR442h-237nacr00442
    • 2021-08-13
    161 min

    [PPPD-952]120 Points For Those Boobs! She"ll Do Anything A Beauty Wouldn"t do. A Convenient Meaty Big Tits Girl"s JAV Debut. Kotoha Ayase

  • ayase is censoredbig titssingle workPPPDoppaiPPPD-952PPPD952pppd00952
    • 2021-08-16
    65 min

    498DDH-028 Even Though I’M Supposed To Be Friends … If I Had A Drink At Home With A Slender Body GAL Apparel Clerk, It Would Be A Nice Atmosphere! Modest Pant Voice And Greedy Hips Gap Cute GAL And Flirting Sex Like Lovers! ＃ 002

  • amateur censoredamateurddhddh-028ddh028498ddh-028
    • 2021-08-26
    485 min

    [NHDTB-569]NATURALHIGH Summer Special. Sensitive (Shameful) Big Tits Pervert 2021 Complete Edition. Sex For All 10 Performers. Hard Nipples Version. 2 Volumes, 8 Hours

  • censoredbig titssquirtingNHDTBnatural highkansukeNHDTB-569NHDTB5691nhdtb00569
    • 2021-09-10
    118 min

    [SSIS-167]She Went On A Business Trip With Her Boss, Whom She Absolutely Hated, And Found, To Her Surprise, That She Was Booked Into The Same Room With Him At The Inn ... This Beautiful Tits Office Lady Was Kept Cumming All Night With His Excessively

  • minami kojima censoredsingle workdramaSSISs1 no 1 stylemaeda bungouSSIS-167SSIS167ssis00167
    • 2021-09-11
    230 min

    [NASH-568]The Showa Theater Of Life And Love: A Nun, A Widow, And A Mature Woman"s Lewd Drama

  • censoredmature womandramaNASHpinkbig brothernadeshikoNASH-568NASH568nash00568
    • 2021-09-17
    156 min

    [MIFD-180]She Loves Pizza! She Loves Sex! An AV Debut That Allows Her To Do Everything She Loves! Nanami Shiozaki

  • nanami shiozaki censoredblowjobbeautiful girlMIFDmoodyzkubo stylemoodyz freshMIFD-180MIFD180mifd00180
    • 2021-09-18
    62 min

    Pacopacomama 091821_533 Mature Lady Piledriver Position BJ : Misato Wakaba

  • amateur uncensoredpacopacomama
    • 2021-09-23
    118 min

    [HBAD-596]After Coming Back To Live At Home And Take Care Of Family, She Ends Up Having To Slurp And Deepthroat A Dick With Teary Eyes During Rough Sex. Hikaru Konishi

  • hikaru konishi censoredblowjobsingle workHBADhibinoumanami jirobabeHBAD-596HBAD5961hbad00596
    • 2021-09-25
    261 min

    [NATR-665]Curvy! Shiori Tsukada

  • shiori tsukada censoredcreampiebig titsNATRpinknadeshikoNATR-665NATR665natr00665
    • 2021-10-02
    141 min

    [EVIS-374]Getting Rubbed By A Booted Slut"s Sweaty Feet And Dirty Talk

  • anne mashiro minami saya censoredlesbianEVISebisusan mousou zokucherry miyamaEVIS-374EVIS374evis00374
    • 2021-10-08
    154 min

    [IPX-747]Coercion From An Intense Older Guy That Makes Me Take His Dirty Dick Every Single Day. Late-night Nurse Call That Signals To A Sexual Service. Nanami Misaki

  • nanami misaki censoredcreampieblowjobIPXidea pocketmaeda bungoutissueIPX-747IPX747ipx00747
    • 2021-11-05
    35 min

    FC2PPV 2406995 Until Tomorrow! Translated By "# 3-2" Ali Runaway Girl. She Has Convulsions In Agony With Intense Piss In The Back Of Her Vagina At The Age Of 18. Creampie In Love ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-11-19
    238 min

    [CJOB-100]Lavish Slick Slut"s Titty Rubbin" - Bathtime Handjob BEST Collection

  • julia shinoda yu censoredsluthandjobCJOBchijo heavenslut heaven bestCJOB-100CJOB100cjob00100
    • 2021-11-23
    134 min

    241GAREA-528 Rikochi (Tsukushi Mika)

  • amateur censoredamateurbeautiful girlgareagarea-528garea528241garea-528
    • 2021-11-25
    125 min

    [FSDSS-318]"Are You Interested In My Breasts？" Getting Hard As She Made Fun Of Me, I Ended Up Having Some Titty Fucking SEX With My Big Breasted Senior - Yuko Ono

  • yuko ono censoredbig titsdramaFSDSSfalenoshrimpfaleno starFSDSS-318FSDSS3181fsdss00318



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored