jav pov javcensored squirting high vision




FC2SPRDHDKAKBIMIAAHZGDNACXNATRSSNIRBDROYDONEZIPXHODVPPPDVEMAGMEMMARAMVSDMEYDCAWD

2020-11-13
180 min

[SQIS-036]Fallen Into Pleasure Hell

  • censoredmarried womandramaSQISfa proSQIS-036SQIS036sqis00036
    • 2020-11-21
    62 min

    10musume 112120_01 BJ In Public Restroom: Would you like to have sex here with me？ Masaki

  • amateur uncensored10musume
    • 2020-11-22
    117 min

    [CAWD-140]Breaking In Niece: I Want My Beloved Niece To Be Exclusively Mine... Jealous Uncle Makes Niece His Very Own Fuck Toy - Moko Sakura

  • sakura moko censoredcreampiebeautiful girlCAWDkawaiitake dCAWD-140CAWD140cawd00140
    • 2020-11-25
    54 min

    FC2PPV 1583493 [Personal shooting / set sale] 33-year-old married woman with well-trained physical beauty and erotic beauty Complete version

  • amateur uncensoredfc2
    • 2020-12-04
    56 min

    [DHT-211]Married Amateur Woman With Issues: Modern Beautiful Married Woman Picked Up Through A Paid Matchup App - Ema, 35

  • censoredcreampiemarried womanDHThot entertainmentmohri smithDHT-211DHT21159dht00211
    • 2020-12-13
    122 min

    [VENU-986]Charming His Step-Mother To Let Him Creampie Her Bubble Butt Everyday Saya Minami

  • minami saya censoredcreampiemature womanVENUvenuskaniefakecest winntersVENU-986VENU986venu00986
    • 2020-12-16
    55 min

    [opcyn-134]まいか(23)

  • amateur censoredcreampiesquirtingopcynopcyn-134opcyn134opcyn-134
    • 2020-12-31
    120 min

    [JUL-434]You Really Want An Old Cougar Like Me...？ - Alone With Her Nephew This Lusty MILF Craves Passionate Adultery - Maki Hojo

  • hojo asahi censoredmature womanslutJULmadonnabieber gonzoJUL-434JUL434jul00434
    • 2020-12-31
    115 min

    [ATID-447]The Enema Fiend Riho Fujimori

  • riho fujimori censoredanalsingle workATIDattackerseitaro hagaein madATID-447ATID447atid00447
    • 2020-12-31
    56 min

    FC2PPV 1626890 Geki Kawa Bishoujo ☆ Pussy Kuppa Vagina Pink! Masturbation over panties makes man juice soaked and finger masturbation! Handjob launch with a vacuum blowjob with tremendous suction! !! It was vulgar.

  • amateur uncensoredfc2
    • 2021-01-17

    FC2PPV 1648961 Limited to 3 days [Individual shooting] Slender thirty wife, sobbing with another stick and vaginal cum shot twice

  • amateur uncensoredfc2
    • 2021-01-19
    72 min

    FC2PPV 1651512 I messed up my slender innocent girl with Lady Gras until it got crazy ~ ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-02
    45 min

    FC2PPV 1669704 [Penis fishing libido girls] Orgy in 3DK! 25 years old, 24 years old, 22 years old pussy ♥ Raw vaginal cum shot party until morning [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-07
    141 min

    [PKPD-132]My Female Acquaintance: Creampies Are OK, 18 Years Old, A Girl With Pale Skin, Pink Nipples, F-cup Rina Takase

  • rina takase censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-132PKPD132pkpd00132
    • 2021-02-12
    162 min

    [MIDE-884]Abstinence Sensitive Pussy: Convulsions, Screaming Acme Squirting From Hard Piston Fuck - Mia Nanasawa

  • nanasawa mia censoredsquirtingbeautiful girlMIDEmoodyzzaku araimoodyz divaMIDE-884MIDE884mide00884
    • 2021-02-15
    197 min

    [PYM-366]Net Cafe Peeping, Ecstatic Orgasm Masturbation

  • censoredamateurPYMprimoPYM-366PYM366h-283pym00366
    • 2021-03-28
    76 min

    300MAAN-638 [The most erotic body in history x Human dying] Is your special skill eating fast？ !! Vacuum W blow job that sucks up with a serious suction power like a vacuum cleaner! !! Constricted beauty big breasts x fair-skinned pie bread! !! IR

  • amateur censoredcreampiebig titsmaanmaan-638maan638300maan-638
    • 2021-04-22
    56 min

    FC2PPV 1779028 First pregnancy discovery in 3Q! I took responsibility and took a Gonzo w [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-06
    73 min

    [REBD-552]Tsubaki 2 Southern Shangri La / Tsubaki Sannomiya

  • sannomiya tsubaki censoredsingle workREBDrebeccaherpes takaREBD-552REBD552h-346rebd00552
    • 2021-05-10
    96 min

    374IMGN-012 Mie (26)

  • amateur censoredcreampieamateurimgnimgn-012imgn012374imgn-012
    • 2021-05-15
    140 min

    [TIKP-058]Slutty Camgirl With Big Soft Titties Rian-chan

  • censoredcreampiebig titsTIKPtikitiki.comerTIKP-058TIKP058tikp00058
    • 2021-05-28
    162 min

    [MIFD-158]A Fresh Face Barely Legal Babe From Tohoku Is Making Her Adult Video Debut Her Family Runs An Apple Farm, And She's A Freshman In Tokyo Who Still Hasn't Gotten Rid Of Her Tsugaru Accent. Hey Mr. Adult Video Actor, I Want You To Fuck

  • mitsuki hirose censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-158MIFD158mifd00158
    • 2021-05-28
    120 min

    [MIAA-440]~ Super Beautiful Woman Gets Ravished By Her Husband's Boss HH]Z]^H

  • hikari hime censoredcreampiebig titsMIAAmoodyzsuisei akaieveryone s porn starMIAA-440MIAA440miaa00440
    • 2021-05-29
    126 min

    390JAC-096 [Continuous Saddle Tide x 20-year-old Professional Student x Raw Saddle 4 Barrage] Pitch Pichi’s 20-year-old enters the freestyle SEX medley! Continuous splash with Saddle tide quick turn! !! Climax butterfly with strangling SEX! !! G

  • amateur censoredcreampiesquirtingjacjac-096jac096390jac-096
    • 2021-06-12
    78 min

    200GANA-2501 Seriously Nampa, first shot. 1647 Show off magic to girls in Harajuku! Bring an interested girl to the hotel! Guide in the erotic direction with magic using condoms! The slender long legs and the crisp buttocks are exposed and disturbed!

  • amateur censoredamateurganagana-2501gana2501200gana-2501
    • 2021-06-14
    90 min

    300MIUM-712 A Beautiful Girl Who Is Too Cute From Any View! !! The tide jet does not stop on the huge breasts that are about to spill. !! Have a look at SEX that you want to pass on to future generations! !! !! : Would you like to skip the company to

  • amateur censoredcreampiebig titsmiummium-712mium712300mium-712
    • 2021-07-02
    63 min

    510ELLO-010 [4 launches of copulation! ] Shion chan Ria chan

  • amateur censoredcreampieamateurelloello-010ello010510ello-010
    • 2021-07-10
    108 min

    [QRDA-130]Sadist Female S*****t Council Group Leg Tease

  • erica censoredanalQRDAqueen roadQRDA-130QRDA130qrda00130
    • 2021-08-06
    68 min

    H0930 ki210808 Chiharu Kawamura 31years Old

  • amateur uncensoredh0930
    • 2021-08-13
    124 min

    [MVSD-474]I Ended Up Sharing A Room With Young Female Graduate With A Slim Waist NTR Special She Let Me Fuck And Come Inside Her Minami Hatsukawa

  • hatsukawa minami censoredcreampiebeautiful girlMVSDm s video groupms video groupMVSD-474MVSD474mvsd00474
    • 2021-08-24
    161 min

    [SDNM-302]Education Mama Hides Her Desires Away. 34-Year-Old Eriko Ishii, Chapter 2. Blindfolded, Tied Up, Deep Throat. Milf Enjoys Masochistic Pleasure And Tries To Beg For Forgiveness As She Gets Lost In It.

  • eriko ishii censoredmature womandeepthroatSDNMsod createakai suiseihonmono hitodzuma dannani naisho de av taikenSDNM-302SDNM3021sdnm00302
    • 2021-09-02
    49 min

    C0930 ki210902 Taeko Kashitani 28years old

  • amateur uncensoredc0930
    • 2021-09-23
    120 min

    [FSDSS-291]"I Won"t Tell Anyone" Big Tits Girl In Tight Swimsuit Wants To Be Fucked In School Nikaido Yume

  • nikaido yume censoredbig titsschoolgirlFSDSSfalenoshidou yasujiroufaleno starFSDSS-291FSDSS2911fsdss00291
    • 2021-10-06
    59 min

    541AKYB-006 Maho (23) SSS Class! G Cup Beauty ♪ ​​(Hono Wakamiya)

  • amateur censoredcreampiebig titsakybakyb-006akyb006541akyb-006
    • 2021-10-08
    95 min

    [HUNBL-063]Party For Deepthroating Big Dicks

  • censoredbig titsdeepthroatHUNBLhunterbajiouhhh groupHUNBL-063HUNBL063hunbl00063
    • 2021-10-16
    120 min

    [AQSH-077]My Junior Colleague"s Beautiful Wife A Man That Knows Her Escort Past Was Her Husband"s Senior Colleague... Rei Kuruki

  • satoshi kuruki censoredcreampiemature womanAQSHaqua mall heroaqua mallAQSH-077AQSH077aqsh00077
    • 2021-10-29
    62 min

    SIRO-4680 [First Shot] [Pink-Haired Flashy Gal] [Thighs Cramping With Relentless Caress] An Apparel Clerk With An Instantly Wet And Sensitive Body That Is Worth Blaming Appears. Contrary To The Lucrative Atmosphere Of Appearance, When A Penis That Ha

  • amateur censoredamateursirosiro-4680siro4680siro-4680
    • 2021-10-30
    243 min

    [XVSR-622]The Complete BEST Works of Kotone Suzumiya. 18 Works and 4 Hours.

  • kotone suzumiya censoredcreampiesquirtingXVSRmax amax ikacalenXVSR-622XVSR622xvsr00622
    • 2021-11-20
    128 min

    [BAB-037]An Unprotected Sex Tour with a Sugar Daddy. Natural Airhead and Very Beautiful Pussy GAL. Iroha Minami

  • minami iroha censoredsingle workBABbabylon daydreamersBAB-037BAB037bab00037
    • 2021-11-21
    82 min

    345SIMM-678 [101cm J Cup! Kansai Dialect Beauty Huge Breasts J ○! ] Even Though It’s Huge Breasts, It Doesn’t Hang Down At All! Uncle And Icharab Sex While Shaking The Non-Standard Beautiful Huge Breasts Against Gravity With Balun Balun ♪!

  • amateur censoredcreampiebig titssimmsimm-678simm678345simm-678
    • 2021-11-25
    113 min

    [NTRD-096]Netralese, My Best Friend And My Mother, Cuckold Case Study, Mayu Suzuki.

  • suzuki mayu censoredmature womansingle workNTRDtakara eizokouji takarashintokaiNTRD-096NTRD09618ntrd00096
    • 2021-11-26
    238 min

    [THTP-053]Record of a Female Teacher who Falls for Lesbian Pleasures

  • censoredamateurblowjobTHTPthree top publishingttpTHTP-053THTP053h-1237thtp00053
    • 2021-11-26
    49 min

    FC2PPV 2433661 [Personal Shooting] Mizuki Face Up 28 Years Old A Healthy And Preeminent Style Married Woman Licks The Whole Body And Cums A Lot Of Super Big Cock! !!

  • amateur uncensoredfc2
    • 2021-11-27
    100 min

    [SHM-041]リアルパパ活女子【緊張してる未成年ボディ】ひかりちゃん 18才専門学生 希望光

  • hope light censoredbeautiful girlsingle workSHMsharksledge hammerSHM-041SHM041h-687shm00041
    • 2021-12-13
    98 min

    116SHN-071 Sensitive Nipple Flirting ● 2022 J ○ Who Was Mischievous By An Ambulance Being Transported / JD Who Was Fucked In A Taxi

  • amateur censoredschoolgirlamateurshnshn-071shn071116shn-071
    • 2021-12-19
    56 min

    300NTK-675 [Superb Style Big Breasts Beauty Layer] [Inevitable Cleavage & Inviting Butt] [Do Nasty Race Queen Sex] Beautiful, Big And Naughty Breasts Are Good! !! Needless To Say, The Face Is Also The Best! !! Introducing The Perfect Layer Without

  • senann censoredcreampiebig titsntkntk-675ntk675300ntk-675
    • 2021-12-25
    77 min

    [MNSE-029][Delivery Only] Uniform J Creampie Individual Shooting Miss Minon, First Shot In The Mouth Minon Aisu

  • aisu mino censoredcreampieschoolgirlMNSEcrystal eizomaniac plusMNSE-029MNSE029mnse00029
    • 2021-12-29
    57 min

    H4610 ki220102 Tomomi Akai 20years old

  • amateur uncensoredh4610
    • 2022-01-08
    157 min

    [EKDV-673]Rara Kudo - Sweet Brand New Maid Gets Bred From Dawn To Dusk - Breaking In The New Girl - Loathsome Master Ravishes Her While She Sobs...

  • lara kudo censoredcreampiedeepthroatEKDVcrystal eizopearl rice sakagamie kissEKDV-673EKDV673ekdv00673
    • 2022-01-14
    56 min

    [ETQR-341][Daydream POV] Total Obedience, Ovulation Day, Slut Maid, And Sex To Have C***dren. Suzume Sho.

  • sho suzume censoredcreampieblowjobETQRerotic timeETQR-341ETQR341etqr00341
    • 2022-01-19
    75 min

    [011922-001]The Undisclosed: Sensitive Masochist Titjob 8

  • amateur uncensoredcaribbeancom
    • 2022-01-22
    239 min

    [OKAX-813]That Girl Is Masturbating？! Don"t Look! I"m Embarrassed, Go Away!

  • censoredblowjobbeautiful girlOKAXk m produceokazuOKAX-813OKAX813okax00813
    • 2022-01-28
    165 min

    [RBK-035]The Slutty Fiance. Akane Shiki

  • akane shiki censoredsingle workRBKattackersusubashisuiryupakuRBK-035RBK035rbk00035
    • 2022-03-12
    158 min

    [KAGN-009](Private Photos) Everywhere Blowjobs 7 11 Girls

  • censoredamateurblowjobKAGNprincess kaguya pt delusional familyikeda owlprincess kaguya ptKAGN-009KAGN009kagn00009
    • 2022-03-11
    64 min

    FC2PPV 2712339 [None] An Active Student Who Is Scheduled To Graduate This Spring, Boasting An Idol-Class Look ♥ Called In Uniform At The End Of School. I Was Stunned By The Big Chin That Stood Up At 45 ° … Telling The Young People Of The Future

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored