javcensored big tit delusion grou high visio creampie




FC2ADNAUKGSPRDEBODAWDONEZNGODVENUSHKDAVSADASDMVSDRBDMIAASQTEMIDEPREDMEYDVEMAFSDSS

2020-11-06
58 min

480FRIN-006 《Personal shooting》 Entertainer 25 years old Free announcer Tall model “AK” Fujite ● SEX leaked video with a talented producer

  • amateur censoredmarried womanamateurfrinfrin-006frin006480frin-006
    • 2020-11-07
    122 min

    [SORA-277]A Slender Cross-Dresser With A Big Cock Is Getting Academic Anal Breaking In Training From A Lesbian Slut He's Cumming Like A Bitch, While Getting His Horny Cock Rock Hard, Over And Over Again... Beatrix Moa Hoshizora

  • beatrix the starry sky censoredlesbianSORAyama to soramaketaro tanizokoSORA-277SORA277sora00277
    • 2020-11-07
    138 min

    [PKPD-119]Interview Fuck Documentary: Interviewing Amateur Actresses, I Straightaway Offered Gonzo Fucking! Saya Minami & Noa Usui

  • minami saya saryu usui censoredcreampiebeautiful girlPKPDfuck group and fun friends daydreamersPKPD-119PKPD119pkpd00119
    • 2020-11-19
    52 min

    H0930 ki201119 Izumi Suenaga 37years old

  • amateur uncensoredh0930
    • 2020-11-23
    116 min

    [GENM-060]Secret Office Sex Eimi Fukada

  • emi fukada censoredblowjobslutGENMgenekifukadaGENM-060GENM060genm00060
    • 2020-12-20
    147 min

    [JUL-420]My Selfish Big Stepsister Ran Away From Home And Came To My Place, And Meanwhile, My Wife And I Were Newlyweds, But She Had Been Depriving Me Of Sex For A Whole Month. Riho Fujimori

  • riho fujimori censoredbig titsmature womanJULmadonnajo styleJUL-420JUL420jul00420
    • 2021-01-02
    49 min

    1Pondo 010221_001 Horny kimono beauty: Yukari Ayaka

  • amateur uncensored1pondo
    • 2021-01-06
    73 min

    FC2PPV 1634443 [Personal shooting / set sale] The body of a 43-year-old mature wife is full of brilliance after ripeness.

  • amateur uncensoredfc2
    • 2021-01-12
    172 min

    1Pondo 011221_002 The Best 10 Of 2020: From 2 To 5 Risa Onodera Emi Aoi Mirai Hanamori Saori Miyazawa

  • amateur uncensored1pondo
    • 2021-01-12
    41 min

    FC2PPV 1633831 Limited quantity 2400pt → 1200pt [Yoga teacher] GoPro video full of immersive feeling ❤️ Beautiful big breasts that come out from the spobra ❤️ Love juice that stains pants even though you have not touched it ❤️ Purchase privilege avai

  • amateur uncensoredfc2
    • 2021-02-03
    61 min

    SIRO-4377 [First shot] [Beautiful office lady of a major company] [Doggy style with a sly face ..] A video of a slender OL with a beautiful appearance. Pleasure does not stop at the piston that becomes intense in the second half .. AV application on

  • amateur censoredamateursirosiro-4377siro4377siro-4377
    • 2021-02-11
    65 min

    FC2PPV 1680935 [No] ♀ 297 Female college student Miyabi-chan, 18 years old, 1st time Dirty back dirt offer to conceive from girls! Dangerous day Ma ◯ Ko is seeded and vaginal cum shot makes her a mom! (LOL)

  • amateur uncensoredfc2
    • 2021-02-13
    119 min

    [DVAJ-498]I Brought My Colleague To A Hotel And She Spent All Night Sucking My Dick And She Just Wouldn't Quit A Plain Jane Office Lady Kawakami-san Nanami Kawakami

  • kawakami nanami censoredblowjobsingle workDVAJalice japank westDVAJ-498DVAJ498dvaj00498
    • 2021-02-20
    98 min

    240TOKYO-416 Tomoka

  • amateur censoredcreampiebig titstokyotokyo-416tokyo416240tokyo-416
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    145 min

    [NSPS-971]The Cuckold Fantasies The Wife Of A Sports Instructor Mao Kurata

  • kurata mao censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-971NSPS971nsps00971
    • 2021-03-06
    51 min

    210AKO-418 IZUMI

  • amateur censoreduniformschoolgirlakoako-418ako418210ako-418
    • 2021-03-09
    139 min

    [STARS-337]School Idol Keeps On Happily Sucking Cock Even After Getting Her Face Covered In Cum! HIkari Aozora

  • hikari aozora censoredschoolgirlblowjobSTARSsod creategoemonsod starSTARS-337STARS3371stars00337
    • 2021-03-15
    72 min

    FC2PPV 1721361 [Individual] Slender intellectual beautiful wife, intelligent tax accountant, 50 years old, accident-level screaming crying Gonzo with pleasure to break [First special price]

  • amateur uncensoredfc2
    • 2021-03-19
    67 min

    326EVA-152 Sase God who can easily win! !! Welcome to take home with a game arcade from the sea pick-up ♪ Echiechi beautiful breasts ass Bachikawa GAL inserts with moist eyes Begging … Tighten Kyun Kyun Vaginal pressure sperm Bulrun ☆

  • amateur censoredamateurevaeva-152eva152326eva-152
    • 2021-03-21
    109 min

    300MIUM-686 [Perfect Idol Class] Rent a cute babysitter with 100 smiles as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoying Asakusa date, lover SEX at the hotel! !! It&#

  • amateur censoredcreampieamateurmiummium-686mium686300mium-686
    • 2021-04-02
    81 min

    FC2PPV 1752257 New students from April. A developing immature body. The erection of immorality does not stop in a real teenage pussy that is neither an adult nor a child, and two mass ejaculations on a young face.

  • amateur uncensoredfc2
    • 2021-04-05
    77 min

    376H-622 Bondage Innocent Uniform Girls ●● Squid With SEX! ＃ Hanane ＃ 18 years old

  • amateur censoredcreampieuniformhh-622h622376h-622
    • 2021-04-13
    66 min

    SIRO-4486 [First shot] [Be careful not to die too much! ] [Pleasure is devoured with a sensitive body ..] An innocent girl with a fluffy way of speaking appears. She begins to leak her sweet sigh with a soft touch, and when she is tampered with the m

  • amateur censoredsquirtingamateursirosiro-4486siro4486siro-4486
    • 2021-04-14
    16 min

    FC2PPV 1748578 [Personal shooting] Shion 20 years old Short SEX remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-04-17
    119 min

    [NNPJ-444]Picking Up Girls On Christmas Day - These Lonely Sluts Are Desperate For Touch - This Married Woman Just Wants To Feel Like A Female Again - A Night Of Horny, Red-B***ded Passions. Housewife With A Family, Ms Seiko (Age 35) NANPA

  • censoredcreampieamateurNNPJnanpa japanNNPJ-444NNPJ444nnpj00444
    • 2021-04-18
    177 min

    [DGCESD-996]- Streaming Only! With Special Footage - Veteran Actress - We Filmed Only What Yui Hatano Wanted To Do

  • yui hatano censoredbig titsmature womanDGCESDcelebrity friendsDGCESD-996DGCESD996dgcesd00996
    • 2021-04-26
    71 min

    [SHH-021]While His Wife Is Nearby, He's Getting Laid At A Massage Parlor He Was Getting A Massage And Sneakily Slipped His Dick Into The Masseuse's Cunt So She Gave Him A Cowgirl Until He Creampie Ejaculated In Her, Because This Little Devil

  • censoredslutSHHnatural highkansukeSHH-021SHH0211shh00021
    • 2021-04-30
    42 min

    FC2PPV 1794755 [500pt] Of course the latest work is also a special sale price ♪ 3P live delivery sex with the most popular sex girl with D cup beautiful breasts ♪ Facial cumshots and bukkake 3 barrage at the end of W blowjob hard insertion!

  • amateur uncensoredfc2
    • 2021-05-05
    240 min

    [SCR-271]Video Of Rough Sex By Horny Men Who Enter The Bathing Area Without Permission - 4 Hours

  • censoredcreampieSCRgrayss crimeSCR-271SCR27112scr00271
    • 2021-05-07
    45 min

    HEYZO 2538 POV Cream Pie Fuck With A Shaved Rookie Call Girl – Mai

  • mai uncensoredheyzo
    • 2021-05-15
    121 min

    [VENX-039]"Are You Getting Excited By Looking At My Underwear？" A Step Aunt Who Sqeezes Every Drop Of Her Step Nephew's Sperm From Her Freshly Taken Off Panties Eriko Miura

  • miura eriko censoredcreampiebig titsVENXvenusrokusaburo mishimafakecest winntersVENX-039VENX039venx00039
    • 2021-05-15
    137 min

    [MKON-052]My Prim And Proper Girlfriend Would Absolutely Never Let Me Fuck Her, But On The School Field Trip, We Got Stay In The Same Inn, Yayyy! But Then She Was Preyed Upon By A Pack Of Horny Bastards Risa Shiroki

  • risa shirojo censoredcreampieschoolgirlMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-052MKON052mkon00052
    • 2021-05-21
    147 min

    [HND-984]She Just Cheated On Her Brand New Boyfriend... But Only Because She Wanted To Get Better At Sex For Him, She Swears! Slut With Short Hair Makes Her Creampie Debut! Rina Uchida

  • rina uchida censoredblowjobbeautiful girlHNDhon nakausa pyonHND-984HND984hnd00984
    • 2021-05-22
    106 min

    [APNS-241]Married Cook At The Worker's Temporary Quarters Used As A Sex Toy Mia Hanesaki

  • mia hasaki censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-241APNS241apns00241
    • 2021-06-23
    112 min

    459TEN-021 [Whip whip! !! ] Assault on the home of the Hcup gal captured in Ikebukuro! !! Bombshell fuck with a special game underwear for gals! !! "I was molested for the first time in 5th grade" Dirty little GAL who has evolved into a plump

  • hbody censoredcreampiebig titstenten-021ten021459ten-021
    • 2021-07-15
    148 min

    [KTB-047]Seductive Girl Natsuho Comes To Work Wearing Outrageously Sexy Office Casual! Bukakke! Businesswoman Suit Club 21 Natsuho Imai

  • natsuho imai censoredbig titsslutKTBkahanshin tigers mousouzokukahanshin tigersKTB-047KTB047ktb00047
    • 2021-07-15
    149 min

    [SORA-323]Going On A Sexy Outdoor Date With A Slut With Super Hot Drooping Breasts And Huge Areolas Iori Yuki

  • yuuki yuuki censoredslutsingle workSORAyama to sorahimu lockSORA-323SORA323sora00323
    • 2021-07-16
    42 min

    FC2PPV 1925653 [None] [Limited To 100 Pieces 2980 → Off To 1480pt! ] Former Local Station Reporter! Appearance Prepared To Wear A Mask That Drastically Reduces Work ♥ ️ Appeal For Vaginal Cum Shot From Yourself! ♥ ️ * Review Benefits / High Image Qua

  • amateur uncensoredfc2
    • 2021-07-22
    118 min

    [MIDE-958]Strong-Willed Female Boss Regains The Pussy Of Her Youth When She Wears A School Uniform For The First Time In 10 Years! A Stud Like Me Was More Than Happy To Fuck Her All Night! Mizuki Aiga

  • mizuki ai censoredcreampieuniformMIDEmoodyzzaku araimoodyz divaMIDE-958MIDE958mide00958
    • 2021-08-01
    120 min

    [NACR-444]欲求不満な息子の嫁に誘惑されて 平井栞奈

  • shiori hirai censoredcreampiemature womanNACRplanet plussakura ninshichi ku ryuuNACR-444NACR444h-237nacr00444
    • 2021-08-14
    149 min

    [GENT-162][Super Lucky] Her Brains Turn To Goop! Yoshiko Is So Cute That It"s Scary, But She Turns Into A Desperate Cum Dumpster Who Begs "Get Me Pregnant And Complete My Life..." Nanami Yokomiya

  • censoredcreampiebeautiful girlGENTgentleman mousouzokubishoujo maniagentleman jientoruman mousouzokuGENT-162GENT162gent00162
    • 2021-08-19
    155 min

    [ABW-132]結城るみな なまなかだし 40 正真正銘ミスコン女王に只管中出し！！！ 【MGSだけのおまけ映像付き 25分】

  • amateur censoredcreampiesquirtingabwabw-132abw132abw-132
    • 2021-08-28
    245 min

    [MCSR-450]Hello. The Horny Older Women Living In The Neighborhood - 18 People, 4 Hours

  • yumi anno nana hirose natsumi horiguchi censoredmarried womanmature womanMCSRbig mocalsaburo kamegashimamuscatMCSR-450MCSR45057mcsr00450
    • 2021-09-02
    63 min

    336KNB-170 Sexless Frustration Explodes For Nearly A Year! Do Not Miss The Dense Sex That Exposes The Tough Slender Body And Is Disturbed By The Instinct Bare! I Will Take A Gonzo With This Married Woman From Now On. 63 At Tsujido Station, Fujisawa C

  • amateur censoredmarried womanamateurknbknb-170knb170336knb-170
    • 2021-09-03
    122 min

    [ADN-344]The Story Of How The Woman I Hired Gave Me A Super Erotic Blowjob Iroha Natsume

  • natsume saiharu censoredblowjobsingle workADNattackersdoragon nishikawaotona no dramaADN-344ADN344adn00344
    • 2021-09-24
    161 min

    [HMN-041]Young Lady Who Works At Traditional Japanese Restaurant In Nihonbashi, Tokyo Rima Kamishiro

  • kamidai rima censoredcreampieblowjobHMNhonnakamamezawa mametarouHMN-041HMN041hmn00041
    • 2021-09-27
    97 min

    FC2PPV 2257439 I Tried To Play Metamorphosis To The Weather Girl Class Tsun Tsun Girls

  • amateur uncensoredfc2
    • 2021-10-19
    108 min

    016DHT-0248 From The North Country … Anal Debut As The Second AV Appearance! Sawa Kurata

  • amateur censoredamateurmature womandhtdht-0248dht0248016dht-0248
    • 2021-11-11
    154 min

    [NHDTB-597]Chasing Creampie 2 -Following A Group Of Gals All Day And Fucking Them All

  • censoredcreampiesquirtingNHDTBnatural highjaken kodamaNHDTB-597NHDTB5971nhdtb00597
    • 2021-11-12
    86 min

    535LOG-004 [Personal Shooting] Loose Fluffy Girlfriend With Cute Chubby Lips! !! The Crotch Gets Hot With Plenty Of Ass And Beautiful Legs That You Want To Lick! It Was A Super Erotic Marina Who Explodes Her Sexual Desire Without Being Accused Of Bei

  • amateur censoredamateurloglog-004log004535log-004
    • 2021-11-13
    155 min

    [KAGN-007](A Private Video Session) A Blowjob, Anytime, Anywhere 5 11 Ladies

  • censoredamateurblowjobKAGNkaguya hime pt mousozokuikeda fukuroukaguya hime ptKAGN-007KAGN007kagn00007
    • 2021-11-17
    69 min

    FC2PPV 2441352 Hold 3 Times Until Registration! !! Midnight [Don Quixote Musume] I Was Stunned By A Large Number Of Facial Cumshots At A Hotel When I Was Called By An Unknown Elderly Person …

  • amateur uncensoredfc2
    • 2021-11-25
    180 min

    [NHDTB-603]Enema. Peeing. Orgasms. Pervert

  • censoredsquirtingNHDTBnatural highjaken kodamaNHDTB-603NHDTB6031nhdtb00603
    • 2021-12-17
    151 min

    [JUFE-352]Bubbly Bombshell Janitor Who Comfortably Heals Our Troubled Minds And Dicks! Rena Momozono

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-352JUFE352jufe00352
    • 2021-12-29
    123 min

    1Pondo 122921_001 Mikan Kururugi Emiri Okazaki: Sexy Actress Special Edition

  • amateur uncensored1pondo



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored