javcensored blowjob big tits jav def




FC2DASDJUFEABWAVSACHRVSPRDSSNIDTTCESDHDKAMARAMVSDMEYDMIAAHZGDVEMALULUSANDASDNGOD

2020-10-09
30 min

[CLO-087]A National Treasure-Level Bitch Is Getting Soiled With Rich And Thick, Pure White Semen. Juria Tachibana

  • tachibana risa censoredblowjobsingle workCLOchobitchchovicCLO-087CLO087h-1435clo00087
    • 2020-10-22
    85 min

    [AKDL-059]This Business Hotel Massage Lady's Tits Were Peeking Out Of Her Shirt, And My Cock Got Rock Hard 11 (Mio-san/C-Cup Titties, Nina-san/F-Cup Titties)

  • hinata cla i m in sakino censoredAKDLaquinorishrikenaknrAKDL-059AKDL0591akdl00059
    • 2020-10-22
    61 min

    SIRO-4296 [First shot] [God milk H cup] [Supreme hugging comfort] Marshmallow girls who are irresistible for chubby lovers. The released H milk is disturbed in front of the camera .. AV application on the net → AV experience shooting 1374

  • amateur censoredbig titsamateursirosiro-4296siro4296siro-4296
    • 2020-10-25
    106 min

    SMUK-031 Haruna

  • amateur censoredschoolgirlamateursmuksmuk-031smuk031smuk-031
    • 2020-10-27
    67 min

    [ETQR-163](Daydream POV) Ordinary Girl x No Makeup = All Natural Beautiful Tits - Naughty After Class Lessons With My F-Cup S*****t Yukino Nagasawa

  • yukino nagasawa censoredcreampiebig titsETQRerotic timeETQR-163ETQR163h-1186etqr00163
    • 2020-10-27
    79 min

    [ssan-010]みあ(28)

  • amateur censoredbig titsamateurssanssan-010ssan010ssan-010
    • 2020-10-31
    73 min

    300NTK-458 Erotic cute girls! !! Urgent participation! !! From wearing erotic … Immediately insert and suddenly SEX without foreplay! !! A cloudy vaginal cum shot that overflows with 3 consecutive vaginal cum shots on a small mako! !! SP that ro

  • amateur censoredcreampieamateurntkntk-458ntk458300ntk-458
    • 2020-11-07
    122 min

    [SORA-277]A Slender Cross-Dresser With A Big Cock Is Getting Academic Anal Breaking In Training From A Lesbian Slut He's Cumming Like A Bitch, While Getting His Horny Cock Rock Hard, Over And Over Again... Beatrix Moa Hoshizora

  • beatrix the starry sky censoredlesbianSORAyama to soramaketaro tanizokoSORA-277SORA277sora00277
    • 2020-11-23
    60 min

    HEYZO 2402 My Real Live Maid Doll Vol.17 -Submissive Cutie All to Myself- – Remi Hashimoto

  • remi hashimoto uncensoredcreampieblowjobheyzo
    • 2020-12-04
    88 min

    [hoi-149]栗山夏(24)

  • amateur censoredbig titsamateurhoihoi-149hoi149hoi-149
    • 2020-12-05
    150 min

    [RBD-999]My Coworker The New Hire Agreed To Be My Girlfriend So Now I Can Have Her Whenever I Want. Hinata Koizumi

  • hinata koizumi censoredbig titsdramaRBDattackersjo styledragonRBD-999RBD999rbd00999
    • 2020-12-08
    126 min

    [KTRA-260]My Stepsister's Little Tits Are Making Me Horny Hinako Mori

  • hinako mori censoreduniformschoolgirlKTRAk tribeKTRA-260KTRA260h-094ktra00260
    • 2020-12-11
    117 min

    [SABA-663]# New Girls In Uniform - Secret Deals For Cash 05 Asuka

  • censoredcreampiebig titsSABAskyu shirototodoSABA-663SABA663h-244saba00663
    • 2020-12-13
    156 min

    [SQTE-349]The Beautiful Y********l in Uniform Who Broke The Rules

  • kiyomiya suzu kanami miura censoredblowjobbeautiful girlSQTEs cuteSQTE-349SQTE349sqte00349
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-20
    59 min

    [srtd-192]りょう(26)

  • amateur censoredbig titsamateursrtdsrtd-192srtd192srtd-192
    • 2021-02-06
    118 min

    [ADN-291]Sweaty Fucking All Over In The Daytime With A Sexually Frustrated Married Woman. Iroha Natsume

  • natsume saiharu censoredsingle workdramaADNattackersnaotootona no dramaADN-291ADN291adn00291
    • 2021-02-20
    58 min

    FC2PPV 1694694 First shot creampie ☆ Pochakawa super erotic girl ♡ Super excited about shaved pussy! Cowgirl piston is too comfortable. I have released the accumulated sperm to the back of the vagina with Dopyu!

  • amateur uncensoredfc2
    • 2021-02-25
    109 min

    [HTHD-183]My Friend's Mother - Last Chapter - Makiko Tsurukawa

  • makiko tsurukawa censoredcreampiemature womanHTHDcenter villagejiro fukagawahona zonoHTHD-183HTHD183h-086hthd00183
    • 2021-02-27
    120 min

    [JUFE-263]Beautiful Secretary With A Nice Plump Body And Colossal Tits Flaunts Her Sexual Desires And Addiction To Cock! Rui Miura

  • rui miura censoredcreampiebig titsJUFEfitchJUFE-263JUFE263jufe00263
    • 2021-03-06
    132 min

    [BBAN-314]Lesbian Gray: What Earns More？ Cash Or A Woman's Body...

  • satoshi kuruki misono waka censoredlesbianbeautiful girlBBANbibianBBAN-314BBAN314bban00314
    • 2021-03-11
    47 min

    302GERK-360 M-san

  • amateur censoredcreampiebig titsgerkgerk-360gerk360302gerk-360
    • 2021-03-13
    145 min

    [SINN-017]This Married Woman Is Okay With Getting Pregnant! A Video Record Of A Beautiful Mature Woman Who Only Gets Excited Through Creampie Infidelity, Now Refined Into A Perverted Cum Bucket "If Possible, I'd Like To Fuck A Man Who Has The

  • censoredcreampiemature womanSINNshinsekai mousouzokuSINN-017SINN017sinn00017
    • 2021-03-20
    45 min

    H4610 tk0031 Yuki Izuta 20years old

  • amateur uncensoredh4610
    • 2021-03-22
    131 min

    240TOKYO-418 Ruka

  • amateur censoredamateurcosplaytokyotokyo-418tokyo418240tokyo-418
    • 2021-04-14
    160 min

    [BLK-495]Sudden Reverse Pick Up Harem Wagon - These Tacky Girls Are On The Hunt For Cock And Won't Take No For An Answer! Aoi Kururugi Ichika Matsumoto

  • aoi kururugi ichika matsumoto censoredcreampieslutBLKkira kirathere is alsokira kira black galBLK-495BLK495blk00495
    • 2021-04-15
    128 min

    [MOPT-006]Long-Legged Stunner Teases Male Subs In Her Pantyhose, Jeans, And Knee-High Boots Renon Kanae

  • kanae lennon censoredanalslutMOPTm o paradisemo tightMOPT-006MOPT006mopt00006
    • 2021-05-01
    150 min

    [PRED-312]On That Furiously Cold, Rainy Day ... I Was With My Elder Sister Type Big Tits Private Tutor, And She Demanded That I Kiss Her More Passionately, And We Warmed Our Bodies With Creampie Sex That Night. Maron Natsuki

  • marin natsuki censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-312PRED312pred00312
    • 2021-05-01
    162 min

    [SSIS-060]Mixed Body Fluids, Hot And Steamy Sex Complete Unedited Special Kozue Fujita

  • kozue fujita censoredsquirtingsingle workSSISs1 no 1 stylemon cSSIS-060SSIS060ssis00060
    • 2021-05-02
    29 min

    FC2PPV 1798612 [Post a real record! ] In exchange for a large reward, a vaginal cum shot! Realistic ● Dating movie! !!

  • amateur uncensoredfc2
    • 2021-05-11
    61 min

    HEYZO 2528 Beautiful Girl’s After School Life No.36 -Enjoying A Girl’s Body In Short Skirt- – Kurumi Tokito

  • kurumi tokito uncensoredcreampieheyzo
    • 2021-06-20
    54 min

    SIRO-4494 AV application on the net → AV experience shooting 1567 [First shot] [Face level S class] [Slender body that shines] I am curious about cute faces and naughty things. Take off the clothes of a fashionable active female college student, a ho

  • amateur censoredsquirtingamateursirosiro-4494siro4494siro-4494
    • 2021-07-10
    127 min

    [KYMI-013]Pin-Up Slut

  • hamazaki mao suzuki mayu censoredslutKYMImiluaida yumenoKYMI-013KYMI013kymi00013
    • 2021-07-14
    122 min

    [TPPN-200]The Up And Coming Rei Futami Gets Both Her Body And Soul Trained To Hell And Back: A Story Of Tender Nurturing And Deep Pleasure Through The Most Depraved Commands

  • rei futami censoredcreampiebeautiful girlTPPNteppanTPPN-200TPPN200tppn00200
    • 2021-07-15
    35 min

    481SACZ-046 Chika 4

  • amateur censoredamateurbdsmsaczsacz-046sacz046481sacz-046
    • 2021-07-25
    59 min

    HEYZO 2574 Pregnant Woman Has High Sex Drive – Nagisa Fujiwara

  • amateur uncensoredcreampieblowjobheyzo
    • 2021-08-06
    68 min

    H0930 ki210808 Chiharu Kawamura 31years Old

  • amateur uncensoredh0930
    • 2021-08-13
    97 min

    529STCV-006 Ren

  • amateur censoredcreampieamateurstcvstcv-006stcv006529stcv-006
    • 2021-08-13
    122 min

    [TPPN-203]Teppan! First Appearance! Sweaty Pervert Training. The Beautiful Girl Who Kept Taking Huge Loads Inside Her Eventually Became Victim Of Lust... Yuuri Fukada

  • yuri fukada censoredbig titsblowjobTPPNteppanTPPN-203TPPN203tppn00203
    • 2021-08-29
    72 min

    FC2PPV 2101993 [Pre-Sale] Mayu-Chan, A Tall Slender Beauty, 4th Time-I Was In Heat With A Race Queen Costume And Decided To Make Two Consecutive Vaginal Cum Shots ♥

  • amateur uncensoredfc2
    • 2021-09-03
    19 min

    FC2PPV 2106810 [Immediate Deletion Of Body Baldness] Depriving The Freedom Of Active K③ Of De M Who Got Acquainted With The Application, The Estrus Of Squirting Madness In The Height Of Youth

  • amateur uncensoredfc2
    • 2021-09-04
    140 min

    [PKPD-156]Amateur Friendship Document: Real Cuckold Personal Filming of Kozue, An Office Lady with Superb Legs Kozue Minami

  • minami kozue censoredcreampiesingle workPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-156PKPD156pkpd00156
    • 2021-09-04
    140 min

    [MMUS-056]The Temptation Of Three Devilish Girls Innocently Showing Their Panties Leads To Instant Erection And Ejaculation!

  • lara kudo yuzu shirakawa censoredslutMMUSmarrionkasai kijinkcpMMUS-056MMUS056mmus00056
    • 2021-09-12
    115 min

    [083PPP-2233]性欲を持て余した若妻がハマる秘密のセンズリ鑑賞倶楽部(1)

  • amateur censoredbig titsamateurpppppp-2233ppp2233083ppp-2233
    • 2021-10-29
    119 min

    [WAAA-111]Amazing Cunnilingus MANIAX, Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesquirtingWAAAwanz factoryWAAA-111WAAA111waaa00111
    • 2021-11-05
    156 min

    [BBAN-350]Forbidden Lesbian Relationship: A Cheeky Gal And Her Serious Teacher - Ema Asahi, Rei Kuruki

  • chaoyang ema satoshi kuruki censoredschoolgirllesbianBBANbibianBBAN-350BBAN350bban00350
    • 2021-11-06
    61 min

    [110621-001]Luxury Adult Healing Spa: No anal, uhhh, please ejaculate a lot in my ass

  • ryu enami uncensoredanalcreampiecaribbeancom
    • 2021-11-13
    114 min

    [DDHZ-013]Woman Addicted to Confinement, A Claustrophobic Business Woman, Riona Hirose

  • rio hirose censoredsingle workDDHZdogmano maru kimore no hitodzumaDDHZ-013DDHZ013ddhz00013
    • 2021-11-20
    130 min

    [CMC-265]The Rules of Lesbos. Cage of the Chains and Desires of Jealousy

  • aya shiomi nanako miyamura censoredlesbianbdsmCMCcinemagickishi tsukasacollectCMC-265CMC265cmc00265
    • 2021-11-25
    24 min

    FC2PPV 2463393 Immediate Scale In 2 Minutes After Meeting In A Room Dedicated To Blow Job → 3 People In A Row With Various Attacks Such As Full-Scale Irama Anaconda Throat Blow Job ☆ Talented Woman Arisa Vol.2

  • amateur uncensoredblowjobfc2
    • 2021-11-27
    240 min

    [JKSR-519]Party Time x Picking Up Girls x Sex! 12 Ladies 4 Hours Hey Lady, Would You Like To Party With Me？ BEST HITS COLLECTION @Shinjuku Local Married Woman Babes Only We Seduced Married Woman Babes Who Seemed To Have Issues And Were Hanging Out At

  • censoredmarried womanamateurJKSRbig mocalobockeypink junkieJKSR-519JKSR51957jksr00519
    • 2021-11-28
    237 min

    [HHH-199]Wife Monitoring Picking Up A Wife On A Weekday Targeting A Naive Wife "It"s Fine If It"s Over The Clothes, Right？" First Experience With A Nipple Orgasm By A Vibrator If It Escalates, It"s Creampie SEX 13 People 4 Hours

  • censoredcreampieamateurHHHtriple hvipHHH-199HHH19978hhh00199
    • 2021-12-01
    142 min

    [DOKS-550]Sit back and enjoy the sensation of the inside of a mouth, gentle slow blowjob

  • minami saya hibiki mine censoredblowjobslutDOKSoffice k ssanagi matsumotoDOKS-550DOKS55036doks00550
    • 2021-12-03
    158 min

    [RBK-029]Breaking In the High S*********l for Sad Play. Rara Kudo

  • lara kudo censoreduniformsingle workRBKattackersusubashi suiryuu bakuRBK-029RBK029rbk00029
    • 2021-12-07
    98 min

    300MAAN-725 [Absolute Obedience Doggie Bitch Dental Hygienist] Bottomless Sexual Desire That Does Not Stop In Search Of Rich Sperm! !! Do м Constitution That Wants To Gokkun With A Cute Face & Wants To Exhaust! !! 3 Shots Inevitable In Agony In A

  • amateur censoredcreampieamateurmaanmaan-725maan725300maan-725
    • 2021-12-08
    48 min

    229SCUTE-1141 Sena (23) S-Cute Sex (Sena Kasumi) Who Devours The Naked Body Of A Busty Beauty

  • amateur censoredbig titsamateurscutescute-1141scute1141229scute-1141



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored