javcensored censored dmm exclusive amateur def




FC2DASDMEYDAWDVEMACESDGVHMILKPREDVENUMIDVWAAAGMEMSHKDBBANROYDAUKSSSISSPRDEBODDTT

2020-09-24
141 min

[SPRD-1328]My Sex Friend From That Time... Was My Friend's Mother - Toko Namiki

  • namiki touko censoredmature womansingle workSPRDtakara eizouohare konaleddinSPRD-1328SPRD132818sprd01328
    • 2020-09-24
    143 min

    [MOND-200]With My Charming Female Boss - Nanako Takamiya

  • nanako takamiya censoredmature womansingle workMONDtakara eizoumimasaka shundaiichi housouMOND-200MOND20018mond00200
    • 2020-09-28
    54 min

    [DHT-170]Reiko Kobayakawa Will Gently And Relentlessly Make You Cum A Cherry Boy Popping Documentary

  • censoredbig titsmature womanDHThot entertainmentkazuki madokaDHT-170DHT17059dht00170
    • 2020-09-30
    53 min

    345SIMM-519 Gonzo SEX with reading mode JD that the ass is recommended! !!

  • amateur censoredcreampieamateursimmsimm-519simm519345simm-519
    • 2020-10-03
    158 min

    [PRED-256]This Sensual Horny Bitch Is Baring Her Asshole And Cumming Like Crazy (She's The Company President's Secretary) She's Working Overtime, Late Into The Night, But She Can't Tell Her Husband About It Aika Yamagishi

  • aika yamagishi censoredanalsingle workPREDpremiumkogoro kindaichielegancePRED-256PRED256pred00256
    • 2020-10-09
    185 min

    [BAZX-253]Career Receptionist Dirty-Girl's Carnal Welcome vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-253BAZX253h-1496bazx00253
    • 2020-10-26
    127 min

    [VGD-211]RIN - Rin Oga

  • sakura rin censoredbig titssingle workVGDhmjmhajime yanaipornograph tvVGD-211VGD211h-172vgd00211
    • 2020-11-19
    478 min

    [OFJE-277]Once In A Lifetime! Nervous Interview In Front Of The Camera & First Undressing Scene Making Her Heart Race! 8 Hours Of Uninterrupted Scenes To First Penetration Sex! The Latest S1 Actresses Uncovered Special Large Release!

  • hinana is non nine yoshitaka censoredbig titsblowjobOFJEs1 no 1 styleOFJE-277OFJE277ofje00277
    • 2020-11-25

    FC2PPV 1583663 * Limited [Uncensored] A fair-skinned simple girl who came to Tokyo from the countryside. Continuous ejaculation-drinking (45 minutes)

  • amateur uncensoredfc2
    • 2020-11-27
    34 min

    FC2PPV 1586029 [Personal shooting with W benefits] A wife who struggles between pride and pleasure. Pride is fragile but crumbles in the vagina that is swirled.

  • amateur uncensoredfc2
    • 2020-12-04
    57 min

    FC2PPV 1589960 [Personal shooting] Appearance / Sayaka 33 years old / De nasty married woman VS super big dick uncle / Belochu rolled raw Saddle cum shot SEX! !!

  • amateur uncensoredfc2
    • 2020-12-05
    77 min

    476MLA-021 [Pool Nampa] The strongest swimsuit gal in the eyes is Momojiri Grind Cowgirl! !! A large amount of love juice soaked in the sheets … Midsummer SEX where the sensual Aegi voice echoes and the slender body jumps! !! !!

  • amateur censoredamateurmlamla-021mla021476mla-021
    • 2020-12-11
    42 min

    [SHYN-136]Female SOD Employee Boxed Into Japanese Strip Games We Play Hardball With Our Location Prep Girl! Production Department Employee Rika Hirose

  • rika hirose censoredbeautiful girlSHYNsod createy 10432sod female employeeSHYN-136SHYN1361shyn00136
    • 2020-12-12
    119 min

    [MIDE-861]I Like To Lick, Not Suck Nozomi Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyzsuisei akaimoodyz divaMIDE-861MIDE861mide00861
    • 2020-12-17
    120 min

    [PPPD-891]My Girlfriend's Stepsister Seduced My Creampie With Her Big Tits Rika Aimi

  • rumi tadami censoredcreampiebig titsPPPDoppaiPPPD-891PPPD891pppd00891
    • 2020-12-22
    152 min

    1Pondo 122220_001 Riina Okamoto: Riina Okamoto Special Edition

  • amateur uncensored1pondo
    • 2020-12-24
    84 min

    [sdgn-010]ちはるちゃん(21)

  • amateur censoredcreampiebig titssdgnsdgn-010sdgn010sdgn-010
    • 2020-12-25
    51 min

    [oretd-820]かんなさん

  • amateur censoredcreampieamateuroretdoretd-820oretd820oretd-820
    • 2021-01-05
    52 min

    HEYZO 2431 Sex Heaven -Playing With Her Zaftig Body- – Kaori Tachibana

  • amateur uncensoredcreampiehandjobheyzo
    • 2021-02-02
    140 min

    [SDDE-643]In-Flight Sexual Services: Uniform, Lingerie, Or Totally Nude 13 - Pussy Spread Wide For Cowgirl - Black Pantyhose Version

  • aishin shinkawa kiyoshi maihara censoredcreampieuniformSDDEsod createsiberia sakaisenzSDDE-643SDDE6431sdde00643
    • 2021-02-05
    71 min

    300NTK-513 SEX apt! !! A beautiful gamer with a tall F cup! !! Even if you lose the punishment game, you can win at the woman on top posture! !! Two shots of continuous vaginal cum shot with E-sports sex of lack of exercise & libido elimination o

  • cmfjd censoredcreampieamateurntkntk-513ntk513300ntk-513
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-24
    48 min

    FC2PPV 1699616 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] ♥ ️ Raw Gonzo to former Tsundere maid ♥ ️ Massive vaginal cum shot! !! ♥ ️ * Review benefits / facial expression masturbation ♥

  • amateur uncensoredfc2
    • 2021-02-26
    51 min

    230ORETD-852 Sara-san 2

  • amateur censoredcreampiemarried womanoretdoretd-852oretd852230oretd-852
    • 2021-03-02
    56 min

    345SIMM-614 Big butt bullet cowgirl that defenseless character can not be alert

  • amateur censoredcreampieuniformsimmsimm-614simm614345simm-614
    • 2021-03-04
    244 min

    [CVDX-438]She'll Suck Up Every Last Drop Of Semen!! Immediately After Orgasmic Creampie Sex, This Horny Old Lady Will Follow Up With A Cleanup Blowjob On His Sensitive Cock 30 Ladies 4 Hours

  • censoredcreampieblowjobCVDXcenter villageCVDX-438CVDX438h-086cvdx00438
    • 2021-03-04
    62 min

    [KBTV-072]A Married Woman Shows A Side Of Herself That Her Husband Never Gets To See Naomi-san

  • censoredcreampiebig titsKBTVKBTV-072KBTV072h-244kbtv00072
    • 2021-03-06
    198 min

    [HUNTA-957]For One Price, You Can Fuck Anyone, For As Much As You Like! As Long As You Pay The Flat Monthly Rate, You Can Stick Your Dick Into Any Of the Female S*****ts Or Even The Female Teacher! Episode 0 0

  • censoredschoolgirlblowjobHUNTAhunterkorosukehhh groupHUNTA-957HUNTA957hunta00957
    • 2021-03-22
    201 min

    [KATU-080]Getting Jerked Off By Beautiful Smooth Thighs 5 Sluts In Miniskirts With Plump Bodies!

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-080KATU080katu00080
    • 2021-04-01
    120 min

    [CLOT-017]Pantyhose Temptation - Mirei Aikawa

  • aikawa mirei censoredcosplaysingle workCLOTplanet plusdirector ocloseCLOT-017CLOT017h-237clot00017
    • 2021-04-15
    240 min

    [NASH-492]Guys And Girls Fired Up For Passionate Fucks - Tongues Entwined Intimately While They Mate 4 Hour BEST Collection

  • censoredcreampiemarried womanNASHpinknadeshikoNASH-492NASH492nash00492
    • 2021-04-26
    51 min

    492JCHA-033 It’s awkward to negotiate a vaginal cum shot for a kid! Immediately Saddle Immediately 2

  • amateur censoredcreampieuniformjchajcha-033jcha033492jcha-033
    • 2021-05-05
    38 min

    279UTSU-504 Ayumi-san

  • amateur censoredcreampiebig titsutsuutsu-504utsu504279utsu-504
    • 2021-05-11
    127 min

    [KMHRS-043]The Dream Of Meru's Most Devoted Follower: Licking And A First Creampie (Heart) - Meru Kusumi

  • kusumi censoredcreampieamateurKMHRSsod createtiger kosakaikimihoreKMHRS-043KMHRS0431kmhrs00043
    • 2021-06-04
    189 min

    [NKKD-211]Dash Cam Cuckholds 19 Beginning To End Footage From Dash Cams Of Taken Women Being Fucked

  • censoredbig titsmature womanNKKDjet eizomanji groupNKKD-211NKKD211nkkd00211
    • 2021-06-11
    120 min

    [MIAA-447]Second Chance Former Celebrity Makes Her Porn Debut! Yurika Hatsumi

  • yurika hatsumi censoredblowjobsingle workMIAAmoodyzmichiru arashiyamaeveryone s porn starMIAA-447MIAA447miaa00447
    • 2021-06-11
    74 min

    328HMDN-371 [Personal shooting] Gonzo with a married woman (32 years old) with SEX addiction. A horny hole that cums just by inserting it. Cheating wife who is disturbed by white eyes while squirting

  • amateur censoredcreampiemarried womanhmdnhmdn-371hmdn371328hmdn-371
    • 2021-07-02
    98 min

    [ADN-327]Forgive Me, Darling... The Pitfalls Of Age-Gap Marriages Natsu Tojo

  • natsu tojo censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-327ADN327adn00327
    • 2021-07-08
    84 min

    413INST-137 [Hinatabokko Girls Are Crazy] Get A Female College Student Playing On The Lawn! The Pussy That Estrus In Spring. Creampie While Grabbing The Young And Best Masterpiece Body! !! [Orgy]

  • amateur censoredcreampieamateurinstinst-137inst137413inst-137
    • 2021-08-27
    50 min

    HEYZO 2618 Sex With Old Men After 3 Yrs’ Absence – Misaki

  • misaki uncensoredheyzo
    • 2021-09-07
    52 min

    H0930 ki210907 Kumiko Moriwaki 33years old

  • amateur uncensoredh0930
    • 2021-09-10
    155 min

    [IPX-732](No Panties) And (Deep Kiss) Losing It To Her Temptations, We Fuck For An Entire Day Over And Over Even Though I Have Work. "Minami" And Her Amazing Love Minami Aizawa

  • minami aizawa censoredblowjobsingle workIPXidea pocketinaballdishIPX-732IPX732ipx00732
    • 2021-09-11
    120 min

    [KAGP-195]Collection Of Fully Nude Amateur Girls 19 Get A Good Look At 11 Girls Filmed As They Bashfully Strip In This Collection Of Fully Nude Shots For Pervy Guys

  • censoredamateurbeautiful girlKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-195KAGP195kagp00195
    • 2021-09-18
    113 min

    FC2PPV 2213464 Limited Time Price! [No Individual Shooting, Leak, Darkness Route Beautiful Girl No. 3 Sequel] A Miracle Reunion With A Super God-Class Beautiful Girl! Uniform Masturbation & Seeding Creampie Sex & Red Micro Bikini Promo & Nak

  • amateur uncensoredfc2
    • 2021-09-18
    111 min

    [DDHZ-012]My Wife Is A Witch Of Nipple Play. My Wife Became A Popular Nipple Teasing Fudol And I Didn"t Even Know It. Kanna Hirai

  • shiori hirai censoredslutsingle workDDHZdogmano maru kimore no hitodzumaDDHZ-012DDHZ012ddhz00012
    • 2021-09-23
    27 min

    FC2PPV 2236541 Roppongi Men’s Esthetic Oil Handjob Hidden Camera / Masturbation Course [Yo Aoi Kurashina (24 Years Old) 19th]

  • amateur uncensoredfc2
    • 2021-09-28
    71 min

    324SRTD-0246 Cheating Video Shooting To Attract Your Boyfriend! ？？ I Should Have Forgotten The Purpose And I’m Serious! (Moe Hazuki)

  • amateur censoredcreampieamateursrtdsrtd-0246srtd0246324srtd-0246
    • 2021-10-09
    135 min

    [CEMD-065]Feeling It Too Much And Wetting Myself a Lot. Excuse Me...Vol. 30, Mina Kitano

  • mina kitano censoredbig titssquirtingCEMDserebu no tomoCEMD-065CEMD065cemd00065
    • 2021-10-18
    82 min

    259LUXU-1454 Luxury TV 1471 A Pianist With An Attractive Plump Glamorous Body With An Adult Sex Appeal Appears In AV In Search Of A New World! The Body That Has Begun To Ripen Sensually Is Outstandingly Sensitive! The Pant Voice That Echoes Annoyingl

  • amateur censoredbig titsamateurluxuluxu-1454luxu1454259luxu-1454
    • 2021-10-19
    60 min

    H4610 ki211019 Chisato Kaneko 26years old

  • amateur uncensoredh4610
    • 2021-11-26
    104 min

    483SGK-055 [Xmas Creampie Special] [Raw Saddle Creampie Super Super Extension] [Bottomless Miraculous Cuteness] [Not Just Cute Climax Ren] [Squirting Pai Pand M] [Fair White Snow Skin Pink Nipples] Get A Pair Of Early Xmas Gifts Je ~! The Cuteness Th

  • xmasgal censoredcreampiesquirtingsgksgk-055sgk055483sgk-055
    • 2021-12-27
    285 min

    [DGCEDG-004]配信限定版 成宮いろはハイパーベスト4時間49分

  • narumiya iroha censoredDGCEDGcelebrity friendsDGCEDG-004DGCEDG004dgcedg00004
    • 2022-01-03
    65 min

    [SHH-032]Nozomi Haneda AV Retirement. A Pervert"s Last Arousal. Public Shame, Group Fucking, Completely Nude Sex, Non-stop BUKKAKE.

  • nozomi haneda censoredbig titssquirtingSHHnatural highraftin maeshiroSHH-032SHH0321shh00032
    • 2022-01-03
    60 min

    [SHH-033]Nozomi Haneda AV Retirement. A Lesbian"s Last Arousal. Passionate Kissing, Orgasms While Scissoring Together, Double-sided Dildo, Simultaneous Heavy Squirting.

  • nozomi haneda censoredbig titssquirtingSHHnatural highraftin maeshiroSHH-033SHH0331shh00033
    • 2022-01-06
    91 min

    328STVF-056 Amateur Skirt In Personal Photo Session At Home Vol.056 4 Amateur Model Beautiful Women Sexual Harassment Fronts For Idol Class Beautiful Women! Maid Cheerleader Uniform Photo Session

  • amateur censoredbig titsuniformstvfstvf-056stvf056328stvf-056
    • 2022-01-13
    85 min

    [IENF-196]A Massage Parlor Where They Always Play With Your Nipples 3

  • mizuki yayoi miho tsuno censoredcreampieIENFienergyienfIENF-196IENF1961ienf00196



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored