javcensored censored uniform amateur creampie




FC2CHRVSPRDWAAAMILKHNDADNNNPJNATRRBDAUKSATIDMEYDHDKAMIDVSQTEFSDSSVENXJUFESHKDBBAN

2021-01-22
70 min

[orex-198]あいなさん

  • amateur censoredcreampieamateurorexorex-198orex198orex-198
    • 2021-01-29
    481 min

    [SCOP-704]SCOOP SUPER BEST 8時間 19

  • censoredcreampiebig titsSCOPk m producek tarouscoop kmpSCOP-704SCOP704h-565scop00704
    • 2021-02-06
    60 min

    FC2PPV 1675350 55th individual shot, completely original, 2 vaginal cum shots, cute whip whip, pudding pudding, 2 vaginal cum shots

  • amateur uncensoredfc2
    • 2021-02-10
    131 min

    [JMTY-043]Interview With Nagi (20) - She Looks Serious, But She Totally Surprised Us With Her Sluttiness. Nagi Mamiya

  • mamiya nagi censoredslutJMTYteacher delusion groupkamagramJMTY-043JMTY043jmty00043
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-21
    158 min

    [HND-954]A Married Woman's Salive, Love Juices And Semen All Get Mixed Up As They Come Out Of Her Pussy - Creampie Sex

  • censoredcreampieblowjobHNDhon nakacontour styleHND-954HND954hnd00954
    • 2021-02-22
    61 min

    JRAI-007 Mine girl Riho

  • amateur censoredamateurjraijrai-007jrai007479jrai-007
    • 2021-03-06
    165 min

    [DVDMS-638]A Normal Boys And Girls Focus Group Adult Video x The Magic Mirror Number Bus A Collaboration Variety Special This Cabin Attendant Who Works For A Major Airline Has Beautiful Legs And Is Enjoying Her First Experience With Squirting While W

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-638DVDMS638dvdms00638
    • 2021-03-12
    115 min

    [FTUJ-001]A 1-night Trip With Mako-chan (21 Years Old)

  • censoredamateurbeautiful girlFTUJordinary girlsFTUJ-001FTUJ001h-1573ftuj00001
    • 2021-03-21
    40 min

    494SIKA-066 Small Milk Fair White Bitch Gal And Creampie 3P

  • amateur censoredcreampieamateursikasika-066sika066494sika-066
    • 2021-03-26
    59 min

    [WKD-040]A Woman's Fall Yuri Honma

  • really censoredbig titsslutWKDwaap entertainmentk westwWKD-040WKD0402wkd00040
    • 2021-03-26
    239 min

    [NASH-479]First Time Shots: Lewd, Beautiful Mature Women - Only Good Women Edition

  • censoredcreampiemature womanNASHnadeshikoNASH-479NASH479h-067nash00479
    • 2021-03-29
    52 min

    292MY-427 Amina Sakashita

  • amateur censoredmarried womanamateurmymy-427my427292my-427
    • 2021-04-21
    93 min

    300MAAN-646 [Mutty nursery teacher / Naked apron / Don Pisha hugging body] Blow job, fucking, breastfeeding handjob … Premature ejaculation & decachin men’s worries solved with gentleness full of maternity of occupational pattern and dir

  • amateur censoredcreampiesquirtingmaanmaan-646maan646300maan-646
    • 2021-05-05
    120 min

    [TUE-112]A Video Of Filthy Intercourse That Took Place In A Car

  • censoredcreampiebig titsTUEglay zteitora eizoTUE-112TUE11212tue00112
    • 2021-05-07
    129 min

    [HODV-21571]Reverse NTR "Hey Boss ... Do You Want To Rest Up At My Place？" This Boss Got Taken Home By His Employee And Taken For A Ride. Marina Saito

  • saitou marina censoredcreampiesoloworkHODVh m pryo inugamiHODV-21571HODV21571
    • 2021-05-15
    123 min

    [DBER-111]Tall Unending Orgasm Chair A Cruel Place You Can Never Escape

  • yano tsubasa oda mako censoredbdsmDBERbabyentertainmentred babeDBER-111DBER111dber00111
    • 2021-05-26
    123 min

    [GS-2016]True Stories: Family Fun [49]

  • niwa sumire censoredGSgoskoichi takahashiGS-2016GS2016
    • 2021-06-12
    155 min

    [MDBK-183]A Members' Only Men's Massage Parlor Using High-class Rejuvenation Oil - Unlimited Ejaculation Service With A Beautiful Esthetician

  • scooping hamazaki mao censoredcreampiebig titsMDBKbazookak taroMDBK-183MDBK183mdbk00183
    • 2021-06-23
    55 min

    FC2PPV 1883083 [Complete amateur 111] Ayana 19 years old, complete appearance G cup super beautiful girl, plain clothes bondage raw insertion

  • amateur uncensoredfc2
    • 2021-06-25
    70 min

    326HGP-027 [Back customs x strongest whip pie JD] 100cm huge breasts! Saddle tide flood! Two consecutive shots of vaginal cum shot & pie shot in the extremely horny glamorous BODY that invites seeding! !!

  • amateur censoredcreampiesquirtinghgphgp-027hgp027326hgp-027
    • 2021-06-26
    186 min

    [JKSR-497]Will You Have A D***k With Me Ma'am？ We Tried Getting A Married Woman To Swallow Liquor - And Cum. @ Shinjuku - Rural Wives Only - Picking Up Married Girls At A Bus Stop With Reasons To Cheat 12

  • censoredamateurJKSRbig morkalprink junkyJKSR-497JKSR49757jksr00497
    • 2021-06-26
    74 min

    [XVSR-602]Masked Couples - Deceiving Women And Deceived Women - Chapter 2 Hibiki Otsuki

  • otsuki sound censoredcreampiedramaXVSRmax ak c takedacalenXVSR-602XVSR602xvsr00602
    • 2021-07-02
    113 min

    277DCV-185 Is it okay to send it home？ case.179 G cup super big! Brain juice vibe masturbation! Continuously roll up outside, Naka, nipples, and brain SP ⇒ T ● kT ● k 35,000 followers! Roppongi Swimsuit Caba Miss #I love showing bras #Squirting squir

  • amateur censoredbig titssquirtingdcvdcv-185dcv185277dcv-185
    • 2021-07-15
    134 min

    [SOAN-062]The Anal PCR Test 300 Anal Cherry Boy Virgins Get Down To Business With An Anal Elder Sister Type Who Gets 2-Hole Fucked For The First Time In A Glory Hole Spasmic Orgasmic Anal Fuck Fest!! The S**ttering Of An Anal Rose A Currently Active

  • censoredamateurSOANyama to soramaketaro tanizokoanal visitSOAN-062SOAN062soan00062
    • 2021-07-15
    127 min

    [GTJ-094]Anal Fuck Sayuki Mogami

  • sayuki mogami censoredanalbdsmGTJdogmatohjirogold tohjiro levelGTJ-094GTJ094gtj00094
    • 2021-08-20
    160 min

    [DASD-910]Deep Kissing And Hips Swinging, A One Night Hotel Stay Where She Can Show Her True Self: I"m In Heat And Can"t Let Go Of Your Cock Starring Mina Kitano

  • mina kitano censoredcreampiebig titsDASDdasmishima rokusaburoDASD-910DASD910dasd00910
    • 2021-09-04
    115 min

    [RPIN-055]I Turned The Calm, Bubbly Teacher Into A Sex Beast!

  • censoredamateurRPINrikopin mousozokuoozora kakeruRPIN-055RPIN055rpin00055
    • 2021-09-14
    74 min

    200GANA-2557 Seriously Nampa, First Shot. 1689 "Why Don’t You Pay For It And Eat Together？ 』 Hyoi Hyoi Will Follow You Norinori Gal! The Low Chastity Idea Of ​​Her Who Accepts Her Drunk Without Resistance When Approaching Her Is Good! Look A

  • amateur censoredamateurganagana-2557gana2557200gana-2557
    • 2021-09-23
    130 min

    [STARS-417]中出し解禁! 生チ〇ポで覚醒!激イキ!大痙攣!本気汁まみれの大絶頂、大絶叫セックス 宮島めい

  • mei miyajima censoredcreampiesingle workSTARSsod createusapyonsod starSTARS-417STARS4171stars00417
    • 2021-09-24
    238 min

    [OFJE-331]"I Want You To Feel More And More Pleasure, With My Tits!!" A Super Pleasurable Rush Of Pre-Ejaculatory Titty Fuck Joy 100 Cum Shots, In All Their Titty Fucks & Breast-Splattering Glory! 3

  • anzai rara miharu hanasaki censoredbig titsblowjobOFJEs1 no 1 styleOFJE-331OFJE331ofje00331
    • 2021-10-07
    168 min

    [NHDTB-589]G*******g Sex At The Sports Bar These Girls Were Stripped Naked And Continuously Fucked As They Trembled In Shame

  • censoredcreampiebig titsNHDTBnatural highrafutin maeshiroNHDTB-589NHDTB5891nhdtb00589
    • 2021-10-08
    150 min

    [JUL-729]I Was On A Business Trip With My Favorite Lady Boss, And To My Surprise, I Was Booked Into The Same Room With Her At The Business Hotel Ryo Ayumi

  • ayumi ryo censoredbig titsmature womanJULmadonnamamezawa mametarouJUL-729JUL729jul00729
    • 2021-10-15
    300 min

    [DVDMS-724]Ready For Their Debut! Magic Mirror Service Series. Office Ladies With Curvy Asses In Professional Suits Come To Work At This Top Company. Compilation Vol. 3. Their Big Soft Asses Are Squeezed Into Tight Suit Pants. These Shy, But Wet Elit

  • censoredamateurDVDMSdeepsfunky haseithe magic mirror mm mm flightsDVDMS-724DVDMS724dvdms00724
    • 2021-10-19
    69 min

    10musume 101921_01 E Cup Amateur Girl Who Has Not Had Sex For 6 Months Couldn’t Put Up With The Sex Drive Riko Sawamura

  • amateur uncensored10musume
    • 2021-10-22
    146 min

    [HMN-067]At The Creampie Bath House, The Girls Always Let Me Ride And Cum Bareback More Than Once Ichika Seta

  • kazuhana seta censoredcreampiebig titsHMNhonnakazack araiHMN-067HMN067hmn00067
    • 2021-10-22
    105 min

    [WZEN-050]Banned 03 Construction Company Office Lady Tomomi (22)

  • censoredcreampiesquirtingWZENwaap entertainmentnaomiWZEN-050WZEN0502wzen00050
    • 2021-10-29
    119 min

    [SHKD-976]4-Timing Neat And Clean Bitch Revenge Fuck Orgy Tsumugi Akesato

  • akari tsumugi censoredcreampiebeautiful girlSHKDattackersmaeda bungoushi yoru akuSHKD-976SHKD976shkd00976
    • 2021-10-29
    119 min

    [MIDE-991]Seeing My Precious Girlfriend Being Enjoyed By The DQNs In Class Using an Aphrodisiac And Made To Have Sex With You Gives Me A Poor Erection Nana Yagi

  • nana yagi censoredsingle workMIDEmoodyzshouten shiroumoodyz divaMIDE-991MIDE991mide00991
    • 2021-11-05
    160 min

    [DVDMS-735]A Normal Boys And Girls Focus Group Adult Video These Stepbrothers And Sisters Are Keeping It In The Family And We Followed Up To See What Was Going On In This Special A Kind And Gentle Big Tits Stepsister And Her Cherry Boy Little Stepbro

  • censoredcreampiebig titsDVDMSdeepssatou tamaoDVDMS-735DVDMS735dvdms00735
    • 2021-11-12
    89 min

    529STCV-036 The Flag-Raising With Adult Sex Appeal The Carnivorous Unequaled Female President Appeared! !! The Woman Who Can Work Is Also Top-Notch! Any Man Can Do It With Super-Dreadnought Tongue Technique! A Model-Class Slender Beauty Squirts Indec

  • amateur censoredcreampieamateurstcvstcv-036stcv036529stcv-036
    • 2021-11-21
    15 min

    10musume 112121_01 Blow Job Full Operation With Obscene Erotic Tongue Nagisa Miyabi

  • amateur uncensored10musume
    • 2021-12-09
    54 min

    FCP-058 [Delivery Only] Absolutely Subjective! !! Sperm Is Almost Exhausted! Super Feeling Good! !! Nipple Licking Handjob ＃ 6 (Natural Mizuki Hinata Rina Arisugawa Amane)

  • amateur censoredamateurbeautiful girlfcpfcp-058fcp058fcp-058
    • 2021-12-10
    125 min

    [JUL-794]This Voluptuous Lady Boss Is Tough On Her Employees, But When I Teased Her, Instead Of Getting Mad, She Let Me Have Sex. Ririko Kinoshita

  • kinoshita rinko censoredmature womanslutJULmadonnabieber gonzoJUL-794JUL794jul00794
    • 2021-12-11
    155 min

    [MKMP-429]Although At Bottom of School Caste, I Had Dream Sex After School Being Sexually Processed By 3 Hotties In Class. Harem Classroom.

  • ichika matsumoto satoshi kuruki censoredcreampiebeautiful girlMKMPk m producerakudamillionMKMP-429MKMP429mkmp00429
    • 2021-12-14
    58 min

    [HEYZO-2678]Akemi Kihara New Soapland Whore"s Quick Suck And Creampie!

  • akemi kihara uncensoredcreampieheyzo
    • 2022-01-08
    116 min

    [NSFS-056]A 2-nights And 3-day Couples Swapping Camp - Iori Nanase

  • iori nanase censoredsingle workdramaNSFSnagae stylejotaro tomiNSFS-056NSFS056nsfs00056
    • 2022-01-12
    200 min

    1Pondo 011222_002 The Best 10 Of 2021: From 1 To 5 Rena Hiiragi Miyu Morita Asuka Motomiya Shiori Yamagishi Hina Hodaka

  • amateur uncensored1pondo
    • 2022-01-14
    93 min

    529STCV-057 ["You Can Ejaculate A Lot On Your Teacher’s Mako ♪" Sweet Voice Teacher And Rational Sexual Intercourse In Sendagi] Natural Useless Man Making Machine! A Naughty School Festival With A Slender Beauty Of A Small Animal System

  • amateur censoredcreampieamateurstcvstcv-057stcv057529stcv-057
    • 2022-01-14
    79 min

    529STCV-051 [Neat And Clean Bitch Who Seduces Classmate Boys With Fluffy H Cup Milk] Jun-Chan And Jun-Chan Of The Table Tennis Club Who Ate All The Boys Of The Same Club Activities! A Genuine Bitch That Is Called "Always A Vagina" At School!

  • amateur censoredcreampiebig titsstcvstcv-051stcv051529stcv-051
    • 2022-01-22
    156 min

    [JUKF-076]Ripe Young Fruit Mitsukichan - Mitsuki Hirose

  • mitsuki hirose censoredcreampiesingle workJUKFjumpjump avJUKF-076JUKF076h-227jukf00076
    • 2022-01-29
    115 min

    [MRHP-005]Beware Of Delivery Problems! Mizuki Yayoi, An Unscrupulous Transporter Who Couldn"t Stand The Sight Of A Married Woman"s Large Buttocks, Which She Could See Even Through Her Clothes, And Who Inserted Herself Into The Woman"s Bod

  • mizuki yayoi censoredcreampiesingle workMRHPmisesu no sugao emanuelyumesaki ichiroumrs no oshiriMRHP-005MRHP005mrhp00005
    • 2022-02-08
    82 min

    435MFCS-005 [Leaked] [Fornication Under The Desk ♪ Online Interview While A Big Pie Job Hunting Female College Student Is Being Tampered With] "Stop … Stop … (Low Voice)" Rejection Confirmed … While Talking To The Interviewer M

  • amateur censoredbig titsamateurmfcsmfcs-005mfcs005435mfcs-005
    • 2022-02-12
    121 min

    [BKD-278]Family Fun [The Abukuma River Road] Mako Oda

  • oda mako censoredcreampiemature womanBKDrubykoji tsujitobijiBKD-278BKD278bkd00278
    • 2022-02-21
    86 min

    326FCT-007 [Super Sensitive Www] Sex Medium ~ ~ ~ Foreign-Affiliated Office Lady Ol Anna (25) (Yuri Sasahara) With Good Sensitivity So That She Will Have Convulsions.

  • amateur censoredcreampieamateurfctfct-007fct007326fct-007
    • 2022-02-22
    68 min

    326NKD-003 [Creampie Tracking 24:00] Perfect Body Ibekon Gal Rolls Up With 3 Chi ● Po! !! 4P Orgy Creampie Cum Ww [Case: 03 / Enjo Kosai] (Rei Hanamiya)

  • amateur censoredcreampiesquirtingnkdnkd-003nkd003326nkd-003



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored