javcensored censored voyeur housewife nampa




FC2ADNSSISVENUHODVRBDCJODAUKGMIAANACRMVSDMILKWAAASHKDCESDFSDSSMIDVNACXWANZDTTPPPD

2020-10-15
245 min

[NPS-403]Real Pickup! They Blush When They're Shown Two Cocks But They Want It So Bad! Lusty Pussies Get Pounded Raw! 121 Orgasms! 10 Creampies!

  • censoredcreampieamateurNPSpeterskensuke kikuchinampazuNPS-403NPS403h-021nps00403
    • 2020-10-16
    61 min

    417SRCN-039 [F Soft Breasts Maid x Demon Chi ● Po] Fluffy Marshmallow F Cup Boobs Serve Chi ● Po Serve Shrimp Warp Acme Squirting Squirting De Nasty Maid Oma ● Ko Raw Chi ● Squid with Po! [Creampie in semen milk]

  • amateur censoredcreampiebig titssrcnsrcn-039srcn039417srcn-039
    • 2020-10-17
    160 min

    [SSNI-894]J-Cup Porn Star Mei Washio Joins The Amazing Amateur Home Delivery Service To Distribute Her Huge Tits - Titty Fuck Cumshot Special

  • mei washio censoredbig titsbeautiful girlSSNIs1 no 1 styletrendy yamaguchiSSNI-894SSNI894ssni00894
    • 2020-11-01
    104 min

    [HIKR-178]I Seduced This College Girl In Miami, And She Was Heartbroken Over Her Boyfriend's Acts Of Infidelity, So I Got A Nice Taste Of Her Body, Honed By Years Of Cheerleader Training, And Flipped Her Limber Limbs Into All Sorts Of Positions I

  • censoredcreampieamateurHIKRhikara delusion grouphollywood saburoHIKR-178HIKR178hikr00178
    • 2020-11-03
    174 min

    [MSFH-035]She's Amazing When She Takes It Off - A Marunouchi Office Lady, Konomi Yoshinaga's AV Debut

  • konomi yoshinaga censoredsingle workMSFHsod createkomatsu 17ms sodMSFH-035MSFH0351msfh00035
    • 2020-11-07
    60 min

    SIRO-4321 [First shot] [Secrets of a maid cafe clerk] [Erogenous zone is left ear] Embarrassing, but I want you to see it. The whole story of a super cute naughty maid shaking with sex .. AV application on the net → AV experience shooting 1386

  • amateur censoredamateursirosiro-4321siro4321siro-4321
    • 2020-11-27
    120 min

    [DIC-079](Still In The Game) Beautiful Big Tits!! A Japanese Taiko Drummer Yu Matsuda Her Adult Video Debut A Super Genius And Super Aggressive Maso Bitch

  • masaru matsuda censoredbig titssingle workDICprestigejurassic yokoyamadiscoverDIC-079DIC079118dic00079
    • 2020-12-23
    21 min

    FC2PPV 1616927 1800pt → 900pt [3P / Appearance] Fair-skinned H-cup busty married woman, continuous vaginal cum shot record with other sticks and rich NTR

  • amateur uncensoredfc2
    • 2020-12-25
    487 min

    [DPEC-017]Daydream Fantasies, Unleashed!! These Big Titty Mamas Gave Off Seriously Baby Play Vibes, So I Came Twice In A Row I Ejaculated Onto Her Hands And Her Titties, And She Gave Me Lots Of Lovey-Dovey Creampie Sex 30 Ladies 60 Consecutive Cum Sh

  • censoredcreampiebig titsDPECdynamite enterprisedynamite platinumDPEC-017DPEC017h-1386dpec00017
    • 2021-01-04
    87 min

    [sd-010]はるかちゃん

  • amateur censoreduniformamateursdsd-010sd010sd-010
    • 2021-01-08
    128 min

    [DIC-081]The Miracle Of Hyogo! Beauty Parlor Babe With Limitless Lust Ran Kusunoki Makes Her Porn Debut - Edged To The Limit Of Her Senses - Her First Multiple Orgasms!

  • kusunoki orchid censoredsquirtingblowjobDICprestigetsuruhashidiscoverDIC-081DIC081118dic00081
    • 2021-01-13
    51 min

    302GERK-343 Miss Riho

  • amateur censoredcreampiebig titsgerkgerk-343gerk343gerk-343
    • 2021-01-22
    227 min

    [SIM-107]My Sexual Routine Is To Take Home A College Girl And Fuck Her This JD Is Cumming Over Because She Undoubtedly Wants To Fuck, So I Happily Obliged And Filmed It All For Your Viewing Pleasure

  • censoredcreampieSIMprestigeamateur pussiesSIM-107SIM107118sim00107
    • 2021-01-22
    55 min

    HEYZO 2463 Lured Call Girl Gets Creampie In Her Private Business – Ena

  • ena uncensoredheyzo
    • 2021-01-26
    42 min

    FC2PPV 1660590 ☆ Half-price opening campaign ☆ Outdoor exposure! Forcibly take out a sensitive slender beautiful mature woman and cum inside SEX! Dirty woman who squirts while being shy ♥

  • amateur uncensoredfc2
    • 2021-01-29
    309 min

    [XRW-969]Breaking In A Married Woman With S&M Creampie Sex 5 Hours

  • momose runa ryu enami ryu censoredbdsmXRWreal workssuginokireal real worksXRW-969XRW969172xrw00969
    • 2021-02-01
    205 min

    [DKSB-104]They Came For The Cash - Amateur Girls Get Their All-Natural Tits Felt Up - 52 Girls Selected!

  • censoredamateurDKSBoffice k sk s bestDKSB-104DKSB10436dksb00104
    • 2021-02-05
    70 min

    FC2PPV 1673748 First shot ❤️ Fair-skinned tall slender natural girl GET! I was at the mercy of a unique world, but only sperm was shot firmly in the vagina ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-19
    233 min

    [BGN-062]Erotic Infinity - Bursting Past The Limit With H-Cup Boobs! Exclusive Debut! Yuka Yuizuki

  • yuzuki yuuka censoredbig titssquirtingBGNprestigemanhattan kimurabeginningBGN-062BGN062118bgn00062
    • 2021-03-11
    99 min

    [SPRD-1386]Step Mother Seduced By Horny Step Son Iroha Fukuyama

  • fukuyama iroha censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1386SPRD138618sprd01386
    • 2021-04-06
    45 min

    358WITH-094 Hinako (20) S-Cute With Tall Twinte Beauty And Creampie Gonzo SEX

  • amateur censoredcreampieamateurwithwith-094with094358with-094
    • 2021-04-09
    120 min

    [EBOD-817]Her First Fan Appreciation Video - 10 Loads! Limitless Creampie Fucks! Hung Amateur Sex (With Her Real Twitter Followers) Natural Nut-Buster Eimi Fukada Cums To You!

  • emi fukada censoredcreampiebig titsEBODe bodyzampaEBOD-817EBOD817ebod00817
    • 2021-04-11
    70 min

    FC2PPV 1764780 [Personal shooting] ♀307 Female college student Hina ◯ -chan 19 years old 1st shot! A fair-skinned busty G-cup lady JD makes her AV debut on a transcendental danger day with a genuine vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-04-15
    114 min

    [VENX-026]One Night And Two Days Of Being Drained Dry By My Wife's Older Sister Who Suddenly Came On To Me

  • narita tsumugi censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-026VENX026venx00026
    • 2021-04-15
    122 min

    [ZEX-403]*Warning* To The Brink Of Breaking! Super Intense Begging For Climax Sex Hono Wakamiya

  • honoka wakamiya censoredbig titssingle workZEXpeters maxZEX-403ZEX403h-720zex00403
    • 2021-04-27
    241 min

    [SDJS-117]Mother's Day Special Variety Show! Showing Our Appreciation For Our Very Own Working Moms! SOD's Got 10 Female Employees Who Juggle Motherhood With Work, And We're Ready To Give Them The Orgasms They Deserve! Medical Exam With S

  • rie hanai chika kaneko censoredmarried womansquirtingSDJSsod createdynanasod female employeeSDJS-117SDJS1171sdjs00117
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    118 min

    [ADN-311]Fucked In Front Of Her Husband - School Friend Reunion Rin Kira

  • kira rin censoredsingle workdramaADNattackerskazumaotona no dramaADN-311ADN311adn00311
    • 2021-05-19
    30 min

    396BIG-105 Hina

  • amateur censoredcreampieschoolgirlbigbig-105big105396big-105
    • 2021-05-27
    68 min

    FCP-019 [Delivery only] << Completely subjective >> Your Ji-Po will definitely be pulled out …! Only handjob won! Beautiful girl handjob!

  • amateur censoredbig titsamateurfcpfcp-019fcp019fcp-019
    • 2021-06-01
    106 min

    [STARS-359]An Early Summer Special! Squirting Squirts! Breaking News She's Been Spasming The Entire Time While On The job, Squirting All The Way, And Even While Pissing Herself, Female Announcer Yuna Ogura Continues To Read The News As If Everyth

  • yuna ogura censoredsquirtingsingle workSTARSsod createyuji sakamotoSTARS-359STARS3591stars00359
    • 2021-06-04
    124 min

    [NGOD-150]Prim, Proper, Pretty Female Teacher With Colossal Tits Makes An Impassioned House Call To A Hung Male S*****t Who's Been Cutting Classes, Only To End Up On The Receiving End Of His Massive Cock And Giving In To The Pleasure! Chitose Yuk

  • chitose in the evening censoredsingle workNGODjet eizomanji groupNGOD-150NGOD150ngod00150
    • 2021-06-17
    130 min

    [DIC-089]セフレに言われるがままAV出演！？憧れのハイスペ美女、本当はSEX大好きな【言いなりドM】英会話教材の営業・4年目 辰巳まり(26) AVデビュー！！

  • amateur censoredamateurdicdic-089dic089dic-089
    • 2021-07-01
    75 min

    FC2PPV 1888113 [Friend’s girlfriend] Aiko ★ One of three friends! It means that two people other than myself were dating, but it’s been a long time since we met again. I’ve always thought that Aiko’s big tits are dangerous, but in

  • amateur uncensoredfc2
    • 2021-07-11
    115 min

    [083PPP-2181]俺の家政婦ミナミさん(3)

  • amateur censoredamateurcosplaypppppp-2181ppp2181083ppp-2181
    • 2021-07-17
    117 min

    [DASD-895]My Girlfriend Was Taken By My Neighbor. "The Older Man Is Sensitive To Sounds And Came To Complain About The Noise Coming Through The Walls" - Arisu Nanase

  • alice nanase censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-895DASD895dasd00895
    • 2021-07-22
    122 min

    [RCTD-413]Naked Oil Kat Lesbian Fight 5

  • tsukasa nagano suzuka walnut censoredlesbianRCTDrocketscarecrowRCTD-413RCTD4131rctd00413
    • 2021-07-31
    102 min

    [VENX-064]The Stepmother and Stepson Who Get It On Two Seconds After The Stepfather Goes Out. Ayane Sezaki.

  • ayane sezaki censoredcreampiebig titsVENXvenuskitano majimeincest vi nasuVENX-064VENX064venx00064
    • 2021-08-05
    113 min

    1Pondo 080521_001 Shino Aoi Megu Memesawa : Sexy Actress Special Edition Shino Aoi Megu Memezawa

  • amateur uncensored1pondo
    • 2021-08-07
    187 min

    [BANS-004]Nihao Saiko 4

  • miyazaki rin eimi kurusu censoredcreampieblowjobBANSniihao saikou mousouzokuBANS-004BANS004bans00004
    • 2021-08-24
    68 min

    498DDH-030 A Nasty Succubus Esthetician Who Takes Customers As A Handball! "Is It Useless？ But I Can’T Pull It Out From My Feelings ♪" Squeeze The Sperm Roots At The Stakeout Woman On Top Posture!

  • amateur censoredcreampiebig titsddhddh-030ddh030498ddh-030
    • 2021-09-14
    65 min

    Pacopacomama 091421_531 Married Woman And Brother-In-Law Suffering From Bad Husband Rina Shirakawa

  • amateur uncensoredpacopacomama
    • 2021-09-16
    68 min

    10musume 091621_01 I’ve Reached A Lot Of Orgasms Today Keiko Eto

  • amateur uncensored10musume
    • 2021-11-06
    121 min

    [SABA-733]Totally POV A Convenient Fuck Buddy Who Will Immediately Cum Whenever You Call. She May Look Cute, But Her Ass And Thighs Are Heavyweight Class! You Can Enjoy Her Voluptuous Beautiful Body To Your Heart"s Content! A Super Maso Obedient

  • censoredcreampiebig titsSABAs kyuu shiroutotodoSABA-733SABA733saba00733
    • 2021-11-19
    242 min

    [HUNTB-144]"You Can"t Masturbate To Any Girl But Me!" Says My Strict Girlfriend. I Want To Break Up With Her, So I Ask Her To Let Me Film Her With Her Friends Instead

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-144HUNTB144huntb00144
    • 2021-12-04
    96 min

    [HOKS-107]The Obscene and Dirty Mother-in-Law

  • mihara sumire ryo fukutomi censoredbig titsmature womanHOKSfa pro platinumogurokku kinzoufa proHOKS-107HOKS107hoks00107
    • 2021-12-25
    138 min

    [DBER-135]Lewd Hound Club. Sacrificial Teasing. Beautiful Girl"s Cum Hell- Part 9: Sad Prey Convlused by Burning Shame And Nectar. Nana Maeno

  • nana maeno censoredschoolgirlbdsmDBERbabyentertainmentkikubonred babeDBER-135DBER135dber00135
    • 2021-12-31
    146 min

    [NNPJ-493]Dripping, Overflowing Eros Company Erotica!! I Met A Sexy Elder Sister Type On Social Media, And To My Surprise ... She Was A SSS-Class High-Class Call Girl From A Famous Service. She"ll Hit You With Follow-Up Eros Company Sexiness To G

  • censoredcreampieamateurNNPJnanpa japanNNPJ-493NNPJ493nnpj00493
    • 2022-01-01
    120 min

    [GMEM-054]Confinement! Shame! Breaking In! Hear Them Scream! Ecstasy! Powerful Orgasmic, Scream-Filled Shameful Breaking In Sessions The Deplorable Downfall Of An Elite Narcotics Investigation Squad Leader She Went Cum Crazy In A Squirting, Orgasmic,

  • hamazaki mao censoredsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-054GMEM054gmem00054
    • 2022-01-13
    61 min

    1Pondo 011322_001 Full Body Massage By A Sailor Cutie: Mei Misaka Mei Misaka

  • amateur uncensored1pondo
    • 2022-01-14
    118 min

    [MIAA-564]A Gal Who Moves To The Countryside Has Nothing To Do, So She Looks Down On A Dominant Guy And Gives Him A Blowjob.

  • rurucha censoredcreampieschoolgirlMIAAmoodyzoosaki hirokoujiminna no kikatanMIAA-564MIAA564miaa00564
    • 2022-01-17
    62 min

    543TAXD-007 Rina (Rina Takase)

  • amateur censoredcreampieamateurtaxdtaxd-007taxd007543taxd-007
    • 2022-01-21
    117 min

    [JMTY-060]Free Vagina File 12: Saki, 35 Years Old - Record Of Getting My Convenient Married Sex Friend To D***k My Cum And Get My Creampie

  • censoredcreampiemarried womanJMTYteacher delusion groupukyo lifeJMTY-060JMTY060jmty00060
    • 2022-01-22
    239 min

    [NASH-637]I"ve Been Forcibly Cuckolded And Now I"m Going Crazy... Chapter 2

  • eriko nakanishi kyoko kubo censoredmature womandramaNASHnadeshikoNASH-637NASH637nash00637
    • 2022-02-06
    63 min

    SIRO-4782 [First Shot] [Shy Gal] [Sensitive Premature Ejaculation Constitution] A Gal Hairdresser Who Has A Maiden Look In Spite Of Her Flashy Appearance. She Blushes Her Cheeks With A Word Blame, But Wets Her Secret Part And Cums Continuously On A H

  • amateur censoredamateursirosiro-4782siro4782siro-4782
    • 2022-02-07
    483 min

    [STEMAZ-065](Deal Set) 173 cm Tall Wife In Her Fifties! Return To Anal Wife Fucked By Husband"s Coworker

  • aoyama ai luna akasaka censoredcreampiemature womanSTEMAZladies emanuelwomen s.company emmanuel discount setSTEMAZ-065STEMAZ065stemaz00065



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored