javcensored creampie def censored school uniform




FC2MILKSANSPRDKSBJONEZAUKGCHRVFSDSSVEMAHMNAVSAHNDWAAAPPPDEBODAUKSAPODVENXKBIMARA

2020-11-06
163 min

[NGOD-137]A Housewife With A Provisionary License 8 Please Approve My Application... Lena Aoi

  • blue censoredmature womansingle workNGODjet eizomanji groupNGOD-137NGOD137ngod00137
    • 2020-11-13
    190 min

    [IPX-558]Fresh Face AV Debut FIRST IMPRESSION 145. Beautiful New Star - Iyona Fujii

  • iyo fujii censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-558IPX558ipx00558
    • 2020-11-17
    62 min

    SIRO-4324 [First shot] [Highest grade G milk] [Sexy husky voice] Big breasts x big butt OL. She shakes the powerful G milk that everyone longs for violently and keeps screaming pleasure with a blurred voice .. AV application on the net → AV experienc

  • amateur censoredbig titssquirtingsirosiro-4324siro4324siro-4324
    • 2020-11-20
    75 min

    FC2PPV 1577558 Limited price for consecutive holidays [Appearance] [Individual shooting] Prefectural Commercial Department ③ Art Department. Bring it to your home and make a vaginal cum shot twice

  • amateur uncensoredfc2
    • 2020-11-23
    84 min

    300MAAN-603 [Cleavage Idol Cosplay in Halloween 2020] Taputapu Boobs + Kiwakiwa Miniskirt Cosplay Selfie Beauty Discovered! !! Invite to a luxurious Halloween-style hotel! Electric masturbation in a tipsy mood! Fully open with the addition of Ji ● Ko

  • amateur censoredcreampieamateurmaanmaan-603maan603300maan-603
    • 2020-12-01
    60 min

    SIRO-4332 [First shot] [Swaying plump breast] [First fucking] Fair-skinned plump F cup receptionist. The cock swells up to the enthusiastic service that holds in the back of the throat .. AV application on the net → AV experience shooting 1406

  • amateur censoredbig titsamateursirosiro-4332siro4332siro-4332
    • 2020-12-02
    68 min

    [KBTV-046]If You Told A Girl Taking Selfies That You'd Let Her Use Your Studio, Would She Fuck You？ We Find Out!

  • censoredcreampieamateurKBTVmessy tvKBTV-046KBTV046h-1514kbtv00046
    • 2020-12-12
    55 min

    C0930 hitozuma1341 Sae Kou 34years old

  • amateur uncensoredc0930
    • 2020-12-22
    186 min

    [SDJS-100]SOD Female Staff - 48yo Maiko Ayase Enjoys 33 Cumshots Before She Leaves The Company! - The Biggest Creampie Orgy Of Her Life! - This Popular Married Woman Gets Fucked By 25 Of Her Fans From Inside And Outside The Company!

  • maiko ayase censoredcreampiemature womanSDJSsod createyazawa ready to receivesod female employeeSDJS-100SDJS1001sdjs00100
    • 2020-12-25
    120 min

    [EKW-065]Services So Spectacular Your Dick Will Melt - It'll Take You Weeks T Book An Appointment At The Huge Tits Massage Parlor Monami Takarada

  • takarada monami censoredbig titsslutEKWwaap entertainmentk westcobra warpEKW-065EKW0652ekw00065
    • 2020-12-29
    57 min

    H4610 tk0027 Kaya Matsushita 20years old

  • amateur uncensoredh4610
    • 2021-01-09
    118 min

    [IPX-599]"I Think I'm Better Than Your Wife..." Cheating Blowjob Sex - Immoral Slut Seduces Married Men To Suck Them Off Tsubasa Amami

  • amami tsubasa censoredcreampieblowjobIPXidea pocketinaballdishIPX-599IPX599ipx00599
    • 2021-01-12
    50 min

    H4610 ki210112 Eri Maeda 19years old

  • amateur uncensoredh4610
    • 2021-01-15
    77 min

    [SALO-034]The Queen Who Breaks In Men And Keeps Them Cumming Until They Go Crazy - Natsuho Imai

  • natsuho imai censoredsingle workSALOk m producesalomeSALO-034SALO03484salo00034
    • 2021-01-23
    154 min

    [DASD-800]Hard Pounding Feels Just Right. G-Cup Titties Bounce For Dick Drilling. Chiharu Hanami

  • censoredbig titsbeautiful girlDASDdasbungo maedaDASD-800DASD800dasd00800
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    150 min

    [FFFS-025]Taking MILFs To A Hotel For A Fuck! Mature Married Sluts Crave Strangers' Cocks - Caught On Camera 22 - Hot Frustrated Cougar Prowling For Younger Men Edition - Ms Mana, G-Cup, Age 40, Just Wants Anybody To Fuck Her - Ms Yuri, H-Cup, Ag

  • censoredbig titsmature womanFFFSmature woman private videos emmanuellemanji groupFFFS-025FFFS025fffs00025
    • 2021-02-14
    91 min

    428SUKE-061 [Unfussy glasses and vaginal cum shot battle] Borrowing a mobile battery, busty glasses girls and Pakopako SP! !! Have sex while drinking alcohol! A well-maintained areola with a beautiful areola! Sensitive tide splash! We will deliver th

  • amateur censoredcreampiebig titssukesuke-061suke061428suke-061
    • 2021-02-19
    38 min

    [BTH-120]Sluts for Rent Yuki Kami

  • yuki god censoredslutBTHchobitchchovicBTH-120BTH120h-1435bth00120
    • 2021-02-28
    140 min

    [KTKL-096]Incredibly Beautiful Y********l Who Auditioned For That Super Popular Idol Group And Almost Made It In Makes Her Dengeki AV Debut - Kurumi Himejima

  • himejima walnut censoredbeautiful girlsingle workKTKLkittyxhearthKTKL-096KTKL096ktkl00096
    • 2021-03-04
    74 min

    [KBTV-069]Theory: Girls Who Wait Around At Meeting Spots Reading Books Actually Love Kinky Sex

  • censoredamateurblowjobKBTVmessy tvKBTV-069KBTV069h-1514kbtv00069
    • 2021-03-13
    240 min

    [MIDE-900]182 Furious Orgasms! 3714 Pussy Spasms! 13478cc Of Serious Pussy Juice! An Abstention Teasing Orgasm Massive Awakening Special!! - After Storing Up All Of Her Lust For 30 Days, She Let It All Out In One Explosive Day - Nozomi Ishihara

  • ishihara hope censoredbeautiful girlMIDEmoody smichiru arashiyamamoodyz divaMIDE-900MIDE900mide00900
    • 2021-03-13
    160 min

    [EBOD-807]That Weekend, While My Parents Were Away ... My Room Turned Into A Hangout Spot For Colossal Tits Bitches.

  • mizuki yayoi rumi tadami censoredcreampiebig titsEBODe bodykitorune kawaguchiEBOD-807EBOD807ebod00807
    • 2021-03-14
    38 min

    275OCHA-084 Ai

  • amateur censoredcreampieschoolgirlochaocha-084ocha084275ocha-084
    • 2021-03-19
    271 min

    [DNW-113]Male Porn Star's Contact Book 14 Amateur Girls Hunting Season! 31

  • censoredcreampiebig titsDNWprestigedocument nowDNW-113DNW113118dnw00113
    • 2021-03-24
    63 min

    326HGP-014 [Back Customs] Beautiful Big Tits! Nice ass! Beauty slimming! The advent of a young wife with an artistic BODY that shakes the world! The theory that Arasa’s genre is the most erotic was true! ？？ Raw vaginal cum shot SEX that gets dru

  • amateur censoredcreampiemarried womanhgphgp-014hgp014326hgp-014
    • 2021-04-01
    63 min

    SIRO-4459 [First shot] [Fluffy natural boobs] [Sorry for all the fans] G milk beauty who sprinkles another dimension of beauty participates in the war! A gravure idol whose first experience in life is shot with a camera .. AV application on the net →

  • amateur censoredamateursirosiro-4459siro4459siro-4459
    • 2021-04-02
    115 min

    [JUL-536]An Adultery Trip Disguised As A Business Trip Ayaka Muto

  • ayaka muto censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-536JUL536jul00536
    • 2021-04-13
    50 min

    FC2PPV 1768376 * Limited time 2980⇒1980pt ★ Amateur wife ☆ Pocha Lori busty wife Marimo-chan re-advents without worrying even if her 23-year-old gets caught by her husband! ☆ Perverted young wife who came to a 3P orgy with sexual desire ♥ Lust for tw

  • amateur uncensoredfc2
    • 2021-04-15
    132 min

    [NYL-004]Tied Up Big Titted Female President Rui Ayukawa 50 Years Old

  • ayukawa rui censoredbig titsmature womanNYLnile daydream tribeichikan abashiriNYL-004NYL004nyl00004
    • 2021-04-16
    128 min

    [MXGS-1181]Members-Only Maid - What Would Happen If We Hired Her For Three Whole Months... Mizuki Yayoi

  • mizuki yayoi censoredcreampiebeautiful girlMXGSmaxingMXGS-1181MXGS1181h-068mxgs01181
    • 2021-04-17
    117 min

    [CJOD-294]This Slut Held Me Down And Made Me Squirt, Blow My Load Over And Over Again, And Give Her A Creampie. Eimi Fukada

  • emi fukada censoredsquirtingslutCJODchijo heavenultimate ryoCJOD-294CJOD294cjod00294
    • 2021-04-21
    15 min

    10musume 042121_01 Please Watch Me Masturbating and Get Hard Mako Ashida

  • amateur uncensored10musume
    • 2021-05-01
    240 min

    [PRED-305]PREMIUM V.I.P Beautiful Girls From The 3 Biggest Production Companies Form A Harem 240 Minute Special Aika Yamagishi Nanami Misaki Mizuki Aiga

  • aika yamagishi nanami misaki censoredcreampieblowjobPREDpremiumusapyonelegancePRED-305PRED305pred00305
    • 2021-05-08
    145 min

    [GMA-019]Tying Up And Training A Married Woman Beautiful Woman Is Fucked To Pay Off A Loan The End Of A Husband's Final Struggle And The Breakdown Of Morality... Chisato Shoda

  • shota chisato censoredmature womanbdsmGMAglobal media annexkikujiro akabaneGMA-019GMA019gma00019
    • 2021-05-16
    53 min

    FC2PPV 1821397 Until 23 1980 [No] A simple fair-skinned slender beautiful girl. She is forced to vaginal cum shot while trembling with fear.

  • amateur uncensoredfc2
    • 2021-06-14
    100 min

    [SHN-065]Sensitive (Shame) Big Titted Slut 2021: Girls With Glasses (Approximate H-cups)/Titty Fuck JP (Approximately F-cup)

  • censoredbig titssquirtingSHNnatural highkansukespecially selected nachu girlsSHN-065SHN0651shn00065
    • 2021-06-19
    118 min

    [CJOD-299]Male Subs Tied Up And Teased With Whispered Dirty Talk Until Their Blow Their Loads - Unlimited Orgasm Soapland Mei Satsuki

  • satsuki mei censoredcreampiebig titsCJODchijo heavenultimate ryoCJOD-299CJOD299cjod00299
    • 2021-06-20
    240 min

    [NASH-530]I Can't Wait Until Tonight! 50-something Stepmoms Who Are Prey To Their Stepsons From Dawn Till Dusk BEST 4 Hours 2

  • censoredcreampiebig titsNASHnadeshikoNASH-530NASH530nash00530
    • 2021-06-20
    305 min

    [SABA-704]Amateur Nude Encyclopedia - Big Tits & Colossal Tits Edition

  • censoredbig titsamateurSABAclass s amateurSABA-704SABA704saba00704
    • 2021-06-24
    145 min

    [ABW-110]美少女と、貸し切り温泉と、濃密性交と。 14 絶対的美少女を一泊貸し切り、山奥の温泉宿へ 七嶋舞 【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurabwabw-110abw110abw-110
    • 2021-06-26
    186 min

    [JKSR-497]Will You Have A D***k With Me Ma'am？ We Tried Getting A Married Woman To Swallow Liquor - And Cum. @ Shinjuku - Rural Wives Only - Picking Up Married Girls At A Bus Stop With Reasons To Cheat 12

  • censoredamateurJKSRbig morkalprink junkyJKSR-497JKSR49757jksr00497
    • 2021-07-06
    51 min

    188HINT-0464 Misaki

  • amateur censoredcreampiemarried womanhinthint-0464hint0464188hint-0464
    • 2021-07-14
    54 min

    494SIKA-097 A Natural Makeup Beautiful Girl Who Wants To See A Naughty Appearance 3P

  • amateur censoredschoolgirlamateursikasika-097sika097494sika-097
    • 2021-07-22
    240 min

    [CLUB-646]Rejuvenating Happy Ending Massage Of A Married Woman 29 - Creampie Negotiation Voyeur

  • censoredcreampiemarried womanCLUBhentai gentleman clubCLUB-646CLUB646club00646
    • 2021-07-23
    102 min

    [VENX-061]My Big Tits Sister-In-Law Is Luring Me To Titty Temptation - I Got Dumped By My Girlfriend, So My Sexy And Kind Big Sister-In-Law Started Soothing Me With Her Big Titties (But The Truth Is That She Hadn't Been Getting Any And Was Just F

  • ayaka morimoto censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-061VENX061venx00061
    • 2021-07-24
    134 min

    [HUSR-239]Picking Up A Beautiful Y********l In Korea! "I Want To Have Sex..." One Month Of Pent Up Lust Is Ready To Explode! She Jumps At The Chance To Suck Cock!

  • censoredamateurHUSRbig morkalbooker thussleHUSR-239HUSR23957husr00239
    • 2021-08-06
    150 min

    [MIAA-487]The Petite Girl Is Matting Pressed By A Fan With A Huge Dick That Came To A Photo Shoot.

  • censoredcreampiedeepthroatMIAAmoodyzakai suiseiminna no kikatanMIAA-487MIAA487miaa00487
    • 2021-08-17
    96 min

    261ARA-500 [Super Cute] [Super Big Tits] Riho-Chan Is Here! She Feels Cute At A Glance, "I Have Few Encounters And I’M Lonely …" She Applied To Satisfy Her Loneliness! [Puru Puru H Cup] If It’S Just This Big, It Will Shake No M

  • amateur censoredbig titsamateuraraara-500ara500261ara-500
    • 2021-08-20
    240 min

    [REXD-379]Sanctions Against The Self-Important Woman: My Dick! "Wow...It"s This Effective..."

  • censoredcreampieREXDreddogroupREXD-379REXD379rexd00379
    • 2021-09-17
    58 min

    Caribbeancom 091721-001 Personal Trainer Seduces Hot Slim Athlete Anri Kizuki

  • anri kizuki uncensoredcreampiecaribbeancom
    • 2021-10-01
    119 min

    [WAAA-104]I"m Constantly Getting My Mouth Plugged By My Lady Bosses, Who Are Seriously Ready To Party, In A Double-Whammy Pussy-Pounding Reverse Threesome Harlem Fuck Fest They Took Me To A Hotel And Showered Me With Slobbering French Kisses Hono

  • tsujii honoka kimishima mio censoredcreampiebig titsWAAAwanz factoryWAAA-104WAAA104waaa00104
    • 2021-11-06
    132 min

    [APAK-205]Fuck Toy In An Innocent Uniform. "This S*****t Gives Into Serious Orgasms And Squirting Pleasure With A Smile On Her Face! Handjob And Drooling Blowjob From This Amazingly Eager And Masochistic Girl" Uika Noa

  • squid censoredcreampieschoolgirlAPAKaurora project annexrkAPAK-205APAK205apak00205
    • 2021-11-16
    60 min

    H4610 ki211116 Rin Sonoda 23years old

  • amateur uncensoredh4610
    • 2021-11-19
    231 min

    [HUNTB-149]"Can"t I Thank You With My Body？ I"m Not A K*d..." Even Though This Runaway Girl Hijacked My Room, She"s So Cute I Kind Of Like Her...

  • censoredcreampieschoolgirlHUNTBhuntercognac kaminohhh groupHUNTB-149HUNTB149huntb00149
    • 2021-11-20
    49 min

    10musume 112021_01 BJ In Public Restroom: It’s Sudden, But Screw Your Cock Into My Pussy, Please. Nagisa Miyabi

  • amateur uncensored10musume



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored