javcensored creampie housewife jav cuckold ntr




FC2CHRVAUKGSSISDASDNATRAWDGVHAVSAVEMAMEYDFSDSSHUNTBPPPDHZGDMARABLKABWMILKDASDCAWD

2020-10-21
115 min

459TEN-006 [Zutto! Convulsions 5 production] Charge to the home of a huge breasts G milk gal caught in Ebisu! !! Bombshell fuck with a special game underwear for gals! !! Bikkun Bikkun Iki Spree Creampie Barrage SEX! !! Full erection does not stop in

  • amateur censoredcreampiebig titstenten-006ten006459ten-006
    • 2020-10-22
    127 min

    [MOND-202]With My Lovely Superior Yuri Honma

  • really censoredmature womansingle workMONDtakara eizohotate ikkandaiichi housouMOND-202MOND20218mond00202
    • 2020-10-27
    57 min

    C0930 ki201027 Nobuko Shibazaki 36years old

  • amateur uncensoredc0930
    • 2020-11-12
    52 min

    345SIMM-551 Kaori / 33 years old / Plump G breast brother-in-law

  • amateur censoredcreampiebig titssimmsimm-551simm551345simm-551
    • 2020-11-19
    120 min

    [OKSN-310]Utter Ecstasy - These Sexy MILFs Are Out Of This World! They Swallow Cocks Whole With Their Incredible Cowgirl Sex For The Ultimate Pleasure!

  • censoredOKSNabc mousouzokuokasan.comOKSN-310OKSN310oksn00310
    • 2020-11-22
    88 min

    300NTK-473 I found a demon milk I cup beauty! !! A beautiful wife of a non-standard beauty cosmetologist who came by handing a pick-up! !! Demonstration of enthusiastic oil application of boobs rushing is inevitable erection! !! Fluffy fluffy love ra

  • amateur censoredcreampiebig titsntkntk-473ntk473300ntk-473
    • 2020-11-23
    115 min

    [HYBR-008]Banging MILFs At The Kindergarten PTA Meeting Serina Tachibana

  • tachibana rena censoredsingle workdramaHYBRhybrid films daydream tribedavielHYBR-008HYBR008hybr00008
    • 2020-11-26
    100 min

    485GCB-002 ○ Rikawa neat and clean hentai, Narumi Hirose, virgin eating! !! !! Ascension climax in the gap of eroticism that is also aggressive with young looks! “More! More!” Pant with the voice of a girl, forbidden eros who wants Chi Po!

  • amateur censoredamateurgcbgcb-002gcb002485gcb-002
    • 2020-11-27
    302 min

    [XRW-947]Sweaty Wet Creampie Sex At Hot Springs - 5 Hours

  • mio morishita anzu momoi censoredmature womanXRWreal worksmanjiroreal real worksXRW-947XRW947172xrw00947
    • 2020-11-27
    49 min

    FC2PPV 1585608 [No / piece] “… I can only do it here ♡♡” This is a dream !？ Miku-chan in uniform and a legal student Saddle !!! This time I went up the stairs of another adult for the first time in my life. * There is an appearance rev

  • amateur uncensoredfc2
    • 2020-11-30
    120 min

    [IBW-802]A Lo**ta Beautiful Girl With A Nice Tan Immoral Videos From A Bus Stop

  • amateur censoredbeautiful girlIBWi b worksIBW-802IBW802
    • 2020-12-22
    122 min

    [MSB-001]Real Footage Of Amateur Married Woman We Found On A Matchup App - She Let Us Show Her Face And Fill Her Pussy Up With Cum!! Fucking Another Man's Wife And Giving Her A Raw Creampie! 6 Years Married / Living In Kanagawa! 2 Year Old K*d /

  • amateur censoredcreampiemarried womanMSBfutureMSB-001MSB001
    • 2020-12-27
    240 min

    [KTKC-104]A Nationwide Erotic Travel Film In Search Of Undiscovered Amateur Girls Who Show Promise. - Okinawa/Hakata/Osaka/Kyoto/Hiroshima/Kumamoto, Etc., And We Even Go Overseas To Thailand And The Philippines Too - 15 Girls x 4 Hours

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-104KTKC104ktkc00104
    • 2020-12-31
    119 min

    [JUL-423]Madonna Exclusive - Snow White Wife - Part Two! Sweat, Saliva, Pussy Juice - Passionate Midsummer Adultery Dripping With Every Kind Of Body Fluid. Azusa Hirose

  • azusa hirose censoredmature womansingle workJULmadonnamametaro mamezawaJUL-423JUL423jul00423
    • 2021-01-01
    138 min

    [SKSK-041]The Best Lover In History - Compensated Cheating E-Cup Amateur, Young Wife Chinatsu Chinatsu Asamiya

  • chinatsu asamiya censoredcreampiebig titsSKSKprestigesukesukeSKSK-041SKSK041118sksk00041
    • 2021-01-08
    147 min

    [HEZ-237]Amateur Wives With Issues - A Beautiful Married Woman We Met On A Dating App vol. 03

  • censoredcreampiebig titsHEZhot entertainmentmori smithhitotzuma hot entertainmentHEZ-237HEZ23759hez00237
    • 2021-01-23
    53 min

    H0930 ki210124 Michiko Akashi 33years old

  • amateur uncensoredh0930
    • 2021-01-24
    147 min

    [FLAV-260]This Perverted Big Ass Athlete Is Our Cum Bucket Tool For Relieving Our Sexual Desires She's A Perverted Horny Sex Addict Who Wants More Cock! Hear Her Scream And Shout And Pant And Moan While Rolling Her Eyes Into The Back Of Her Head

  • minami saya censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-260FLAV260flav00260
    • 2021-02-07
    120 min

    [SNTJ-017]Former Rugby Player Takes Her to a Hotel, Films the Sex on Hidden Camera, and Sells it as Porn. vol. 17

  • censoredamateurbeautiful girlSNTJsojitsusha mousouzokuSNTJ-017SNTJ017sntj00017
    • 2021-02-11
    128 min

    [MEKO-204]All New "The Old Lady Rental" Service 08 I Heard About This Housecleaning Service That Would Let You Have Creampie Sex, So I Decided To Make Even More Extreme Demands

  • censoredcreampieamateurMEKOmature woman laboMEKO-204MEKO204h-1160meko00204
    • 2021-02-12
    31 min

    [CLO-123]Cleavage Shots ... Her Bulging Big Tits Look So Naughty Underneath Her Clothes Haruka Koide

  • haruka koide censoredbig titsblowjobCLOchobitchchovicCLO-123CLO123h-1435clo00123
    • 2021-02-16
    22 min

    FC2PPV 1688925 Limited to 3 days [Individual shooting] Prefectural Commerce Department ② Book Girl. Record of the last date of winter vacation. It is conceived with violent continuous vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-02-19
    60 min

    [PARATHD-3118]I Found Out That My Lady Boss Was Working As A Delivery Health Call Girl, So Now I Can Take Advantage And Get All The Free Sex I Could Ever Want (6) Workplace: Advertising Agency A Mean Chief Executive 39 Years Old

  • censoredbig titsamateurPARATHDparadise tvPARATHD-3118PARATHD3118parathd03118
    • 2021-02-19
    129 min

    [OMHD-004]Erotic Possession - Your Wish For A Woman's Body Has Come True Rika Aimi

  • rumi tadami censoredbig titslesbianOMHDdogmamigiwa otaOMHD-004OMHD004omhd00004
    • 2021-02-27
    130 min

    [BSTC-052]承認欲求の塊！ 勘違いEカップ女子をコラボ撮影とダマして被虐調教！ 嫌がりながらも潮吹き白目剥きアクメ！

  • censoredcreampiesquirtingBSTCbostonBSTC-052BSTC052h-1117bstc00052
    • 2021-03-04
    115 min

    435MFC-086 Super horny slut who is immersed in pleasure by inserting two holes at the same time [Gonzo ＃ Ayaka ＃ 25 years old ＃ G cup]

  • amateur censoredcreampiebig titsmfcmfc-086mfc086435mfc-086
    • 2021-03-21
    139 min

    [JUL-512]One Box Of Condom's Worth Of Sex H

  • marika kobayashi censoredmature womansingle workJULmadonnasatsugu koyamaJUL-512JUL512jul00512
    • 2021-03-21
    116 min

    [NNPJ-435]We Seduced This Beautiful Half-Japanese Babe Who Lives Overseas On Social Media And Convinced Her To Make Her Adult Video Debut

  • censoredamateurblowjobNNPJnanpa japanNNPJ-435NNPJ435nnpj00435
    • 2021-03-22
    119 min

    [GENM-078]Forbidden Relation: The Other Side Of Work - Mari Takasugi

  • mari takasugi censoredblowjobsingle workGENMgenekig 3GENM-078GENM078genm00078
    • 2021-04-01
    120 min

    [CLOT-017]Pantyhose Temptation - Mirei Aikawa

  • aikawa mirei censoredcosplaysingle workCLOTplanet plusdirector ocloseCLOT-017CLOT017h-237clot00017
    • 2021-04-01
    70 min

    FC2PPV 1750583 [Individual shooting] ＃ 45 Idol face ass J 〇 and after-school sex Premature ejaculation with too good sensitivity 〇 Plenty of raw chicks in and out [Leaked] [Limited]

  • amateur uncensoredfc2
    • 2021-04-02
    96 min

    [SHKD-939]Married Office Girl Mercilessly Re-Employed Karen Otoha

  • karen otoha censoredsingle workSHKDattackerssayaka datesharkSHKD-939SHKD939shkd00939
    • 2021-04-03
    45 min

    H0930 ki210404 Ikuko Ishigaki 44years old

  • amateur uncensoredh0930
    • 2021-04-06
    60 min

    499NDH-012 A metamorphosis beauty OL who carries My electric massage machine! While selling toys to children at a department store, close contact sexual intercourse with a new member of society who wants to comfort frustration with sex toys! !! [Is i

  • amateur censoredamateurndhndh-012ndh012499ndh-012
    • 2021-04-22
    69 min

    FC2PPV 1781596 ☆ New sale ☆ [3P orgy / anal opening] I entrusted you to like a young married woman, so Ikase the demon, thoroughly increase the sensitivity with anal development and teach the joy of a woman with continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-04-28

    FC2PPV 1791400 [Uncensored / Individual shooting] * Again, bring my best friend’s sister to the hotel … change into uniform and vaginal cum shot again.

  • amateur uncensoredfc2
    • 2021-05-17
    56 min

    FC2PPV 1821913 [Active CA, 18th] Sayuri ♡ 22 years old ♡ Cute, beautiful breasts, bristle record ♡ With benefits

  • amateur uncensoredfc2
    • 2021-05-20
    125 min

    [ARM-981]Girls Show Off Their Pussies And Anuses In Three Sexy Poses

  • mihina azumihina mihina nagai yamamoto renka censoredanalARMaroma planningmania satoshiaromaARM-981ARM981arm00981
    • 2021-06-01
    88 min

    451HHH-024 AV First Experience [Overwhelmingly Good Guy Feeling] [I Love Chi ● Ko] [Shining Thigh] It looks simple, but the contents love sex! First check the smell ● This sommelier vs 60 over actor. Witness a loving vaginal cum shot spun across gene

  • amateur censoredcreampieamateurhhhhhh-024hhh024451hhh-024
    • 2021-06-01
    130 min

    [NACR-431]Horny Moms - Chitose Yuki

  • chitose in the evening censoredbig titsmature womanNACRplanet plusdirector onanakuruNACR-431NACR431h-237nacr00431
    • 2021-06-12
    121 min

    [AVSA-168]SUPER FISHEYE FETISHISM Intense Exciting Sex Scene Fleshy Pheromone-Filled Body In Sexy Cosplay Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workAVSAavs collector sbuddha davscollector sAVSA-168AVSA168avsa00168
    • 2021-06-19
    148 min

    [JUL-620]This Rare Bride With A Beautiful Face Is Finally Ready For Her First Creampie! All Alone For A Sweaty Fuck With A Gorgeous Part-Timer... Hitomi Honda

  • honda hitomi censoredcreampiemature womanJULmadonnakitorune kawaguchiJUL-620JUL620jul00620
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    112 min

    [XRL-012]Idol Applicant Training Course: Father's Interview! With Hikaru Minazuki

  • hikaru minazuki censoredcreampiedeepthroatXRLreal worksreal real worksXRL-012XRL012xrl00012
    • 2021-06-20
    99 min

    [KIR-036]Beautiful Snack Mama Shuri Yamaguchi

  • yuri yamaguchi censoredcreampiemature womanKIRstar paradisekirei star paradiseKIR-036KIR036h-254kir00036
    • 2021-07-02
    53 min

    FC2PPV 1882727 [Personal shooting] Chitose 26 years old Massive launch to delicate and petite newlywed Lori erotic man wife

  • amateur uncensoredfc2
    • 2021-08-02
    42 min

    248HDG-563 Madam JAPAN Sensitive Wife Reina

  • amateur censoredmarried womanamateurhdghdg-563hdg563248hdg-563
    • 2021-08-07
    176 min

    [EKDV-665]Popping My C***dhood Friend"s Cherry... My Old Friend"s Now A Raging Slut - When She Heard I Got My First Girlfriend, She Offered To Show Me How It"s Done Mitsuki Nagisa

  • scooping censoredcreampiesingle workEKDVcrystal eizoue kissEKDV-665EKDV665ekdv00665
    • 2021-08-10
    151 min

    [STARS-425]Memories Of Summertime Where A Locally Famous Slutty Gal Milks So Many Cumshots Out Of Me, Hibiki Natsume

  • natsume hibiki censoredbeautiful girlsingle workSTARSsod createyazawa reshi busod starSTARS-425STARS4251stars00425
    • 2021-08-14
    131 min

    [TIKB-118]Miyatan: A Devilish, Slutty Sucking Friend - Miyabi Midorikawa

  • midorikawa miyabi censoredcreampiebig titsTIKBchikichikiba gu mousozokuTIKB-118TIKB118tikb00118
    • 2021-08-19
    244 min

    [CVDX-460]Hard Nipples!! Slender Small Tits Lady"s Amazing Fucking, 30 Women 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-460CVDX460h-086cvdx00460
    • 2021-08-26
    109 min

    [GS-401]This Female Employee Insisted That She Would Be Wearing A Bikini This Summer Once She Became A Member Of Society, She Was Determined To Wear A Bikini This Year, So She Went To The Beach, Where She Would Be Seduced, And Then She"d Fuck A H

  • censoredschoolgirlamateurGSsosoru garconjuria noGS-401GS401h-101gs00401
    • 2021-09-04
    110 min

    [AWD-129]Fakecest: My Stepmom"s Perfect Ass - The Big Ass Of My Sexually Maniacal and Perverted Stepmom, Hitomi Misono

  • hitomi misono censoredbig titsmature womanAWDrubyyanoguchi susumunext doorAWD-129AWD129awd00129
    • 2021-10-08
    241 min

    [HUNTB-110]Welcome To The Government"s Official Sex Training Center. Let"s Get A Sex License! Must Be Certified Before You Cum! There"s So Much Information Out There These Days, It"s Easy To Get Confused.

  • censoredcreampieblowjobHUNTBhunterkorosukehhh groupHUNTB-110HUNTB110huntb00110
    • 2021-10-08
    150 min

    [JUL-729]I Was On A Business Trip With My Favorite Lady Boss, And To My Surprise, I Was Booked Into The Same Room With Her At The Business Hotel Ryo Ayumi

  • ayumi ryo censoredbig titsmature womanJULmadonnamamezawa mametarouJUL-729JUL729jul00729
    • 2021-10-15
    146 min

    [MUDR-166]It"s After School. This Girl Looked Like A Pushover, So We Took Her, And Surrounded Her With A Ring Of Dirty Old Men, And Soiled Her With Bukkake, Relentlessly, Over And Over And Over Again ... Hikaru Minazuki

  • hikaru minazuki censoredblowjobsingle workMUDRmukuMUDR-166MUDR166mudr00166



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored