javcensored high vision image idol celebrity jav




FC2KBIEBODSQTESSNIMIAAPPPDNACRSHKDMEYDSANAUKGFSDSSLULUHMNMARAAUKSADNWANZVENURBD

2020-09-21
180 min

[AMOZ-058]Picking Up MILFs For Creampies - Naughty Mature Hotties With Shaved Pussy - Hard Creampie Fucks With 12 Married Sluts

  • censoredcreampiebig titsAMOZamateur box daydreamamateur boxAMOZ-058AMOZ058amoz00058
    • 2020-09-24
    116 min

    [SPRD-1325]Family Fun - A Stepmom Gets Creampied By Her Stepson For The First Time - Chika Takase

  • tomoka takase censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1325SPRD132518sprd01325
    • 2020-09-24
    198 min

    [NHDTB-440]Slobbery, Perverse Kissing 4 This Perverted High S*********l Presses Her Body Against A Middle Aged Man, And Licks Him All Over

  • censoredschoolgirlslutNHDTBnatural highsakurai baniraNHDTB-440NHDTB4401nhdtb00440
    • 2020-09-25
    217 min

    [SIM-091]Younger Stepsister Disappointed By Her Boyfriend's Tiny Dick Notices That Her Stepbrother's Hugely Hung After A Ten-Year Reunion And Can't Help But Straddle His Massive Cock Cowgirl Style And Ride Him Until She Cums Wild!

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-091SIM091118sim00091
    • 2020-09-30
    68 min

    FC2PPV 1518196 [Complete amateur 89] Mirai 19 years old Part 4, cum shot sex with plain clothes, naked dildo masturbation, bondage exposure masturbation and so on

  • amateur uncensoredfc2
    • 2020-10-15
    34 min

    [GRMR-003]上司と部下がダブルベッド1つのホテルで、AVを見てしまったら… 高坂あいり

  • airi takasaka hiroomi nagase censoredbig titssingle workGRMRmura chleo hakusanGRMR-003GRMR003h-1534grmr00003
    • 2020-10-22
    121 min

    [JRZE-001]Entering The Biz At 50! Chikage Misaki

  • chikage misaki censoredcreampiemarried womanJRZEcenter villagekotaro misatojurakuJRZE-001JRZE001h-086jrze00001
    • 2020-10-30
    89 min

    [MBRBA-067]三井来夢 原宿系モデル×インフルエンサー 衝撃の出演！

  • censoredMBRBAspice visualMBRBA-067MBRBA0675050mbrba00067
    • 2020-10-31
    127 min

    240TOKYO-404 Mizuki

  • amateur censoredsquirtingamateurtokyotokyo-404tokyo404240tokyo-404
    • 2020-11-04
    131 min

    [GVH-143]Perverted Medical Records Of Licking An Old Town Doctor's Face And Getting Creampied By Him - Mio Hinata

  • hinata clan censoredcreampiesingle workGVHglory questGVH-143GVH14313gvh00143
    • 2020-11-10
    138 min

    [KTRA-253]Creampie In My Little Pigtailed Stepsister's Peach-colored Pussy - Hina Kamino

  • jinno hina censoredschoolgirlsisterKTRAk tribeKTRA-253KTRA253h-094ktra00253
    • 2020-11-12
    135 min

    [NSM-025]An Aphrodisiac Oil Massage Shameful Voyeurism & Creampie Sex With Amateur Girls VOL.25 When These Girls Get A Compound Of Massage Oil And Powerful Aphrodisiacs Rubbed Into Their Pussies, They Find Themselves Shocked At How Hot And Horny T

  • mizusawa tsumugi harukawa rino censoredcreampieNSMnishi shinjuku massage main officeaphrodisiac massageNSM-025NSM025h-1342nsm00025
    • 2020-11-20
    56 min

    FC2PPV 1576393 Limited discount until tomorrow! [Married Woman / Orgy Individual Shooting] Pururun Big Breasts I Cup Cheating Married Woman Kokoro-san Penis Deliciously Chablis Crazy Meat Stick Addiction Wife Anal * Spread out and expose to Ahe and f

  • amateur uncensoredfc2
    • 2020-11-23
    118 min

    [AVSA-145]Half-Japanese Exchange S*****t From Argentina Gets A Creampie! Cheer Dancing & Hot Sex Latin Style Erotics!! EMILY

  • emily hikari sakuraba censoredcosplaysingle workAVSAavs collector sbuddha davscollector sAVSA-145AVSA145avsa00145
    • 2020-11-29
    126 min

    [SQTE-346]All-Natural Sex With A Bushy Bush Vegan Little Devil Urara Kanon

  • hanaoto urara censoredblowjobbeautiful girlSQTEs cuteSQTE-346SQTE346sqte00346
    • 2020-12-05
    89 min

    [sdgn-009]さりなちゃん(21)

  • amateur censoredcreampiebig titssdgnsdgn-009sdgn009sdgn-009
    • 2020-12-08
    483 min

    [KTRA-263]Getting Naughty With My Stepdaughter 10 Girls, 8 Hours, 2 Discs

  • asami tsuchiya yui kasugano censoredbeautiful girlKTRAk tribeKTRA-263KTRA263h-094ktra00263
    • 2020-12-31
    130 min

    [SHKD-922]The G*******g Plan The New Employee Mahiro Ichiki

  • mahiro ichiki censoredsingle workSHKDattackerssharkSHKD-922SHKD922shkd00922
    • 2021-01-04
    35 min

    396BIG-095 Hinako

  • amateur censoredcreampieamateurbigbig-095big095396big-095
    • 2021-01-10
    152 min

    [CESD-964]Tsugumi Mizusawa Finally Ready For Her First Lesbian Experience - Her Girl-On-Girl Three-Some Lesbian Lust Awakening Tsugumi Mizusawa Rena Aoi Mihina

  • tsugumi mizusawa blue censoredlesbianmature womanCESDceleb no tomoCESD-964CESD964cesd00964
    • 2021-01-20
    59 min

    345SIMM-593 Dense third round with a horny female college student who took it home and even took a voyeur, but Gonzo is also OK!

  • amateur censoredcreampieamateursimmsimm-593simm593345simm-593
    • 2021-01-23
    63 min

    FC2PPV 1655827 [Complete first shot x marshmallow boobs] Healing girl with a G cup that is too soft! Wrapped in fluffy boobs that everyone loves and sinks! ？？ I can not stand it and a large amount of vaginal cum shot * Complete appearance

  • amateur uncensoredfc2
    • 2021-01-29
    39 min

    FC2PPV 1664540 Until 1st 1980pt → 1580pt [Personal shooting] Slender married woman nurse with thick stranger stick and 3P continuous vaginal cum shot. Let me massage oil and squirt M man.

  • amateur uncensoredfc2
    • 2021-02-06
    150 min

    [SSNI-986]142 Extreme Orgasms! 5500 Body-Wracking Spasms! 2200 cc Of Squirting! Sexy, Slender, Barely Legal Babe Destroyed With Orgasms - Her Ecstatic Erotic Awakening And Retirement Special Kanon Tsukishima

  • tsukishima kanon censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-986SSNI986ssni00986
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-02-23
    48 min

    FC2PPV 1698917 It feels good to hit the uterus with the tip of the chin ☆ Creampie + micro bikini × Usamimi = Mechakyawa girlfriend ♪

  • amateur uncensoredfc2
    • 2021-02-25
    107 min

    [IENF-126]Sexy Older Sisters With Big Tits Talk Dirty To You As They Play With Their Nipples And Jerk Off 5

  • hosei lily tsujii honoka censoredbig titsIENFienergyienfIENF-126IENF1261ienf00126
    • 2021-03-10
    12 min

    Caribbeancom 031021-001 Close Up Pussy: Sakura Kojima

  • sakura kojima uncensoredcaribbeancom
    • 2021-03-11
    123 min

    [GS-378]Back-Arching Aphrodisiac Oil Massage Parlor Newly Opened Oil Massage Parlor For S********ls Who Want To Feel Like Women!

  • censoredGSsosoru x garconred ballGS-378GS3781gs00378
    • 2021-03-13
    24 min

    FC2PPV 1724979 [Beautiful girl’s wall! The first price revolution! ] When you cosplay, you switch on. .. .. [S-ki beauty, Ka-chan debuts! ] Suddenly sperm was squeezed out with a total of 3 shots from the blow job

  • amateur uncensoredfc2
    • 2021-03-24
    106 min

    459TEN-015 [Super-class God Milk] Charge into the home of an H-cup active female college student! !! Bombshell fuck with special game underwear! !! F cup in 5th grade, now H cup ridiculous god milk sparks a man’s instinct! !! Squeeze sperm with

  • amateur censoredbig titsamateurtenten-015ten015459ten-015
    • 2021-04-15
    45 min

    FC2PPV 1770793 [Limited to 3 days, 40 off] [Soft milk banzai] Chinatsu ★ Big breasts married woman ♪ Amazing boobs over the meter! 100cm dripping soft milk I cup milk is rubbed until it is deformed w A man’s yogal face is my favorite ☆ But a slu

  • amateur uncensoredfc2
    • 2021-04-29
    126 min

    [JRZE-045]Entering The Biz at 50! Keiko Itagaki

  • keiko itagaki censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-045JRZE045h-086jrze00045
    • 2021-05-01
    120 min

    [PRED-306]"Sorry... Darling..." My Husband Transferred Away For Work, And Now I Can't Resist My Neighbor's Temptation... I Gave In And Took His Creampie Yuki Takeuchi

  • yuki takeuchi censoredcreampieslutPREDpremiumhiromichi hoseelegancePRED-306PRED306pred00306
    • 2021-05-02
    120 min

    [SCD-192]Fifty Something Step Mother Gave Me An Aphrodisiac And Seduced Me With Sexy Lingerie Yuna Amami

  • yuna amami censoredmature womansingle workSCDrubykoji tsujiscoopSCD-192SCD192scd00192
    • 2021-05-27
    79 min

    200GANA-2491 Seriously Nampa, first shot. 1641 A genuine blonde Caucasian beauty who walks dashingly on Omotesando! When you gently touch her ears, she looks stunned … Maybe she’s weak against pushing, she shows off her pure white naked bod

  • amateur censoredamateurganagana-2491gana2491200gana-2491
    • 2021-06-01
    247 min

    [ZMAR-042]Totally! Ian Hanasaki

  • hanasaki ia censoredcreampiemature womanZMARplanet plusmaruttoZMAR-042ZMAR042h-237zmar00042
    • 2021-06-10
    63 min

    336KNB-158 Divorce Determination! !! !! A big explosion of dissatisfaction with a husband who is sexless and has strong bondage! !! Duero wife ww who is disturbed by other sticks as if to relieve anger I will take a gonzo with this married woman from

  • amateur censoredcreampiemarried womanknbknb-158knb158336knb-158
    • 2021-06-16
    161 min

    [MVSD-469]Extreme Nipple Harem - Nipple Squeezing And Sucking! Nipples Teased From Every Direction For The Ultimate Nipple Pleasure! Ichika Matsumoto Aoi Kururugi Rena Aoi

  • ichika matsumoto aoi kururugi censoredcreampiebeautiful girlMVSDm s video groupsamoariMVSD-469MVSD469mvsd00469
    • 2021-06-25
    62 min

    328HMDN-376 [Individual] Saddle a 48-year-old married woman with a ripe body that is too obscene. A compliant mature woman who gets cancer by a young man and picks up a black nipple and gets caught in a pussy where juice drips

  • amateur censoredbig titsmarried womanhmdnhmdn-376hmdn376328hmdn-376
    • 2021-06-25
    120 min

    [WAAA-072]My Girlfriend Was Fucked All Night By Her Coworkers After Getting Turned On During A Raunchy Party Game On A Business Trip Eimi Fukuda

  • emi fukada censoredcreampiedeepthroatWAAAwanz factorywanzWAAA-072WAAA072waaa00072
    • 2021-06-29
    55 min

    FC2PPV 1894709 [Individual shooting] I was looking for a place where a runaway beautiful girl would stay

  • amateur uncensoredfc2
    • 2021-07-04
    95 min

    DCH-005 Rin

  • amateur censoredcreampieamateurdchdch-005dch005dch-005
    • 2021-07-14
    119 min

    [MVSD-472]Nipple Angel in a White Robe, Little Devil's Smile Healing Bitch Ejaculation, Nurse, Rin Miyazaki

  • miyazaki rin censoredbeautiful girlslutMVSDm s video groupMVSD-472MVSD472mvsd00472
    • 2021-07-22
    483 min

    [FCDSS-011]A Horny Big Tits Elder Sister Full Course Service Slut Plays Yuko Ono Best Hits Collection 8 Hours

  • yuko ono censoredbig titsslutFCDSSfalenofaleno starFCDSS-011FCDSS0111fcdss00011
    • 2021-07-23
    123 min

    FC2PPV 1935583 Celebration! Extra 10,000 Followers Commemorative Extra! [No Individual Shooting, Fcup Beauty Witch, Shocking Ntr Exposure] It Is A Shocking Content That Can Not Be Written In The Title. Affair-Related Catastrophic Past 1 Egg Demon Ntr

  • amateur uncensoredfc2
    • 2021-07-27
    71 min

    300NTK-612 [Namaiki Kansai Beauty Gal Kimo Uncle Ji ○ Seeded Pleasure Fell! !! ] Fucking Cheeky P Activity Expedition Gal Negotiations & Netinechi Uncle Tech And Pleasure Fell From Disgust In The Direction Of Pleasure! !! The Temptation To Insert

  • amateur censoredcreampieamateurntkntk-612ntk612300ntk-612
    • 2021-08-06
    149 min

    [HODV-21596]I Filmed An AV! A Convenient Devilish Little Slut With G-cup Breasts - Yuka Hoshi

  • yuka hoshi censoredcreampiebig titsHODVh m pHODV-21596HODV215965642hodv21596
    • 2021-08-27
    144 min

    [T28-603]Sweet Stepdaughter Sisters With Nice Tan Lines Lala Kudo Ichika Nagano

  • lara kudo ichika nagano censoredbeautiful girlT28tmaT28-603T2860355t2800603
    • 2021-09-10
    77 min

    [stcv-020]あいな

  • amateur censoredcreampieamateurstcvstcv-020stcv020stcv-020
    • 2021-09-11
    41 min

    362SCOH-047 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [Time ● Kyouzo] Akari Niimura

  • amateur censoredcreampiebig titsscohscoh-047scoh047362scoh-047
    • 2021-09-17
    53 min

    FC2PPV 2214167 [Uncensored] Pleasure Awakens With The First 3P !! Two Different Iki Intense Heat Sex Mari (21 Years Old) & Rie (20 Years Old)

  • amateur uncensoredfc2
    • 2021-09-30
    90 min

    FC2PPV 2274183 At The Age Of 19, It’s Been A Few Months Since My First Experience! First Shot Despite Being Inexperienced! Genuine Active Model, Active Female College Student, Complete First Shooting, 170 Cm, G Cup "Personal Shooting" In

  • amateur uncensoredfc2
    • 2021-10-10
    75 min

    200GANA-2573 Seriously Nampa, First Shot. 1672 "Why Don’T You Record Asmr？" → Move To The Studio ”And Pick Up! Let Me Record The H Sound … I Was Surprised At Her Face When I Was Doing Something, So Sex As It Is! (Kanna Sugawara)

  • amateur censoredamateurganagana-2573gana2573200gana-2573
    • 2021-11-05
    38 min

    FC2PPV 2405470 * Active Model * Leaked * Early Sale Planned * Squirting Destroys The Camera! Creampie In A Perverted Model ♡ * Rare Thing * You Can See Without All Moza In The Review Privilege *

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored