javcensored high vision mature woman big tits censored




FC2JULLULUAWDVENUSANSHKDGVHPPPDKBIHNDSQTESSISWAAAMEYDMIDEHDKAFSDSSNGODSSNIGMEM

2020-10-05
70 min

IDJS-016 Tsugumi

  • amateur censoredcreampieamateuridjsidjs-016idjs016idjs-016
    • 2020-10-07
    64 min

    FC2PPV 1526404 [Personal shooting / set sale] Mature wife who seems to have high pride brought in full version

  • amateur uncensoredfc2
    • 2020-10-10
    48 min

    FC2PPV 1528782 [Personal shooting] No.020 Minami-chan ★ Glamorous and cute beautiful female college student. The etch that you really feel on the shaking boobs is the best ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2020-10-10
    118 min

    [IPX-553]Sister-in-Law's Unaware Biting Can't Resist Her Butt In A G-String, For Mid-Summer Runaway Creampie From-The-Back Piston! Yume Nishimiya

  • yume nishinomiya censoredcreampiesisterIPXidea pocketdishIPX-553IPX553ipx00553
    • 2020-11-06
    33 min

    FC2PPV 1559489 [If you get caught, it ’s dangerous → Appear on your own! ] Ota friend ❤ I can not refuse if I ask God milk JD many times ❤ Big breasts G cup boobs Prun Prun while raw cock Pakopako Dokun ❤ Byu ❤ I will cum inside (with Full HD benefit

  • amateur uncensoredfc2
    • 2020-11-11
    21 min

    FC2PPV 1566494 * 1800pt → 900pt [Limited quantity] GOT 〇 Affair activity. Saddle naked on the balcony of the hotel, then bring in separately and convulsions with a squirting piston

  • amateur uncensoredfc2
    • 2020-11-13
    120 min

    [IPIT-009]-- Bad Teacher -- The Hot Blonde Who Fucking Devours Her S*****ts Extreme Temptation!! Emma Lawrence

  • emma lawrence censoredblowjobslutIPITidea pocketzampaaipoke excavation projectIPIT-009IPIT009ipit00009
    • 2020-11-19
    21 min

    Caribbeancom 111920-001 Pussy Encyclopedia: Rin Miura

  • rin miura uncensoredcaribbeancom
    • 2020-11-23
    56 min

    10musume 112320_01 I played around with a married woman who came to the restaurant’s home delivery YASUDA HARUMI

  • amateur uncensored10musume
    • 2020-11-27
    130 min

    [DFE-048]Please Cum In The Back Of My Throat. Aya Shiomi

  • aya shiomi censoreddeepthroatsingle workDFEwaap entertainmentikkyu senfearlessDFE-048DFE0482dfe00048
    • 2020-12-06
    101 min

    [ANB-182]How I Became My Mother-In-Law's Sex Toy - Unleashed! Her Incredible Erotic SK**ls! Haru Kanade

  • play censoredmature womanslutANBrubysusumu yanokuchinobleANB-182ANB182anb00182
    • 2020-12-12
    34 min

    FC2PPV 1604023 Limited [Individual shooting] Prefectural Art Department ③ A girl with short black hair gets fucked for her mother and sister after school

  • amateur uncensoredfc2
    • 2020-12-17
    146 min

    [SSNI-947](Strange Orgasms) Erotic Awakening! Real, Hard, Non-Stop Sex Until Her Horniness Is Exhausted Izuna Maki

  • izuna maki censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-947SSNI947ssni00947
    • 2020-12-22
    59 min

    279UTSU-475 Yuminasan

  • amateur censoredcreampiemarried womanutsuutsu-475utsu475279utsu-475
    • 2020-12-27
    257 min

    [GAV-057]Giving Unauthorized Thick Semen Filled Creampies To Soapland Girls

  • censoredcreampiebig titsGAVgogo avGAV-057GAV057gav00057
    • 2021-01-01
    62 min

    DIZ-011 Roa

  • amateur censoredcreampiebig titsdizdiz-011diz011diz-011
    • 2021-01-01
    129 min

    [SY-194](New: Tiny Room) Now That This MILF's Got Two Young K*ds Of Her Own, She's Overflowing With Motherly Affection (Married Woman Nozomi Haneda, Age 32)

  • nozomi haneda censoredcreampiemarried womanSYplumkanda river bluesamateur only plumSY-194SY194h-113sy00194
    • 2021-01-22
    91 min

    [PITV-023]Sexy Nakedness - Honoka Kadowaki

  • kadowaki honohana censoredbig titsbeautiful girlPITVpistilPITV-023PITV0235581pitv00023
    • 2021-01-29
    302 min

    [SKMJ-143]Amateur College Girls Only! Thigh-Fucked With Their Panties On Until They're So Horny They Wanna Take It Raw! Slick Slits Rubbed With Dicks Until They're Begging For A Raw Creampie! - Sensitive Naughty Girl High-Speed Thrusting Edit

  • censoredcreampieamateurSKMJred face girlone topSKMJ-143SKMJ143h-1324skmj00143
    • 2021-02-04
    64 min

    336KNB-140 I want money to build a house and apply for AV! A sexually active wife who is not satisfied with having sex with her husband every day is urged by a crazy look. I will take a gonzo with this married woman from now on. 35 at Negishi Station

  • amateur censoredbig titsmarried womanknbknb-140knb140336knb-140
    • 2021-02-19
    107 min

    277DCV-176 Is it okay to send it home？ case.170 Reiwa’s Explosive Queen Appears! ⇒ [Takamine no Hana working at Mega Bank] A drastic change with sake! Succubus sucking man’s semen every night! ⇒ Series first decachin 3P … Endless that

  • amateur censoredbig titsamateurdcvdcv-176dcv176277dcv-176
    • 2021-02-25
    128 min

    [MOND-210]With My Female Boss Who I Adore - Yuuka Hirose

  • yuka hirose censoredmature womansingle workMONDtakara eizohotate ikkandaiichi housouMOND-210MOND21018mond00210
    • 2021-03-03
    50 min

    FC2PPV 1710019 ☆ First shot ☆ Complete appearance ☆ Tight and healthy body & transcendental instrument ♥ The limit of patience for adult sex appeal! Massive launch ♥ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-10
    33 min

    [SDFK-043]"Couples Only" Magic Mirror Allows You To Steal Away The Girl Of Your Dreams And Fuck Her Raw! Aya-san (23 Years Old) Office Worker

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-043SDFK0431sdfk00043
    • 2021-03-12
    138 min

    [SUPA-574]Becoming My Sex Friend - Kanon

  • censoredcreampieamateurSUPAskyu shirotogenius hizaSUPA-574SUPA574h-244supa00574
    • 2021-03-16
    133 min

    [ACZ-007]The Sex Pet Collector Vol.05 The Domesticated Widow Risa

  • censoredamateurbdsmACZsanwa publishingabnormal.companiesACZ-007ACZ007h-019acz00007
    • 2021-03-26
    243 min

    [NASH-473]Hot And Steamy Older Woman Soapland World Class Service From A Voluptuous Sexy Forty Something MILF

  • sachiko ono shinobu oshima censoredcreampiebig titsNASHnadeshikoNASH-473NASH473h-067nash00473
    • 2021-04-01
    120 min

    [CLOT-017]Pantyhose Temptation - Mirei Aikawa

  • aikawa mirei censoredcosplaysingle workCLOTplanet plusdirector ocloseCLOT-017CLOT017h-237clot00017
    • 2021-04-02
    56 min

    [NTTR-061]Possessed S********l Runaway! She Never Thought She'd Sell Her Body Quite Like This! Her Sweet Young Body, Used By Horny Adults... Shizuku Asahi

  • asahi drop censoredcreampiebeautiful girlNTTRsod createbijutsu takatakeoverNTTR-061NTTR0611nttr00061
    • 2021-04-09
    146 min

    [IPX-635]I Can't Live Without Sex Anymore... 159 Incredible Orgasms, 2048 Pussy Spasms, 3211 Thrusts, Squirting With Pleasure, Her Erotic Awakening Miu Shiromine

  • shiramine miu censoredsquirtingsingle workIPXidea pocketdragon nishikawadishIPX-635IPX635ipx00635
    • 2021-05-22
    88 min

    [SHM-035]シロウト女子個人撮影ハメ撮り日記 きれい系ド変態性欲モンス あやさんDかっぷ 塩見彩

  • aya shiomi censoredSHMsharksledge hammerSHM-035SHM035h-687shm00035
    • 2021-06-02
    88 min

    300MAAN-659 [Sweat Duck x Orgy] "Sayaka-san"’s Marunage Request! Soul and soul full sex! Eat steak and keep shaking your hips as long as you keep fit! Massive squirting inevitable lack of water! Enjoy long-time sex in a state of sweat, t

  • amateur censoredcreampiesquirtingmaanmaan-659maan659300maan-659
    • 2021-06-05
    120 min

    [KCDA-304]Super Tight Miniskirt: A Super Slutty OL Who Tempts Men With Her Erotic Ass

  • censoredbig titsslutKCDAdigital arkdigital ark digital arkKCDA-304KCDA304kcda00304
    • 2021-07-13
    60 min

    511SDK-012 [Personal shooting] Gonzo date secretly to a frustrated nympho beauty husband who masturbates in the passenger seat

  • amateur censoredamateursdksdk-012sdk012511sdk-012
    • 2021-07-18
    145 min

    [FLAV-274]An Enchanting and Lewd Bunny Girl is a Carnivorous Masochistic Slutty Bitch. Runa Shimotsuki

  • shimotsuki runa censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-274FLAV274flav00274
    • 2021-08-01
    60 min

    FC2PPV 1949957 [No] Rookie. When I Committed It Raw, It Was A Trained Horny Female Of De M [First-Come-First-Served Price]

  • amateur uncensoredfc2
    • 2021-08-06
    119 min

    [IPX-709]The Nightclub Hostess Who Gives You Blow Jobs, Makes You Come A Multiple Number Of Times, And Licks You Dry Tsubasa Amami

  • amami tsubasa censoredcreampiebig titsIPXidea pocketzampatissueIPX-709IPX709ipx00709
    • 2021-08-20
    240 min

    [MGDN-159]Stepmom Feast 4 Hours, Stepson Makes Her Cum...

  • sugawa yuzuki mari aso censoredmarried womanmature womanMGDNstar paradisemegadonMGDN-159MGDN159h-254mgdn00159
    • 2021-08-21
    159 min

    [GNAX-058]VIP - 1BOX - CAR Harem Fucking Reverse Pick Up Tour

  • miki maejima shiori tsukada censoredsluthandjobGNAXnagiranagira kenzonagira nagiraGNAX-058GNAX058gnax00058
    • 2021-09-01
    120 min

    [NACR-453]The Runaway And Me Kasumi Ikeya

  • kazumi ikeya censoredblowjobmature womanNACRplanet plussakura ninshichi ku ryuuNACR-453NACR453h-237nacr00453
    • 2021-09-04
    116 min

    [XVSR-610]The Sexy, Steamy Married Woman"s Secret Temptation To Sexual Cuckolding And Reverse Sexual Cuckolding, Yui Hatano

  • yui hatano censoredcreampiebig titsXVSRmax ayoshida ikuzoucalenXVSR-610XVSR610xvsr00610
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-15
    146 min

    [ZEX-407]The Ultimate Slender Beauty. Best Of Rena Aoi.

  • blue censoredsingle workZEXpeters maxpi ta zu maxZEX-407ZEX407h-720zex00407
    • 2021-10-01
    34 min

    FC2PPV 2281430 [No] [Limited To 100 Pieces 2980 → Off To 1480pt!] Excited To Be Seen By People! Metamorphosis Beauty ♥ ️ Even Though I Have A First-Class Secretary Test … Lol, ♥ ️ Massive Vaginal Cum Shot! !! ♥ ️ * Review Benefits / High Image Q

  • amateur uncensoredfc2
    • 2021-10-01
    149 min

    [MIAA-507]My Slutty Stepdaughters Came To Visit And Do Their Mother"s Part While I Was Working Away From Home, Starring Lala Kudo and Rina Takase

  • lara kudo rina takase censoredcreampiebeautiful girlMIAAmoodyztakarase hironoriminna no kikatanMIAA-507MIAA507miaa00507
    • 2021-10-06
    88 min

    229SCUTE-1135 Ema (19) S-Cute Beautiful Black-Haired Girl Panting Indecently Sex (Ema Chaoyang)

  • amateur censoredamateurbeautiful girlscutescute-1135scute1135229scute-1135
    • 2021-10-09
    58 min

    H0930 tk0043 Yukie Nishiaki 35years old

  • amateur uncensoredh0930
    • 2021-10-19
    50 min

    FC2PPV 2358369 Make The Receptionist Naked! Watch All The Crazy Appearances Of The Boxed Girl (Maybe)! !! !!

  • amateur uncensoredfc2
    • 2021-10-26
    120 min

    [SAN-023]A Cuckold Wife Who Became Absorbed By The Strong Body And Cock Of Mikawaya - Sakura Tsuji

  • sakura tsuji censoredcreampiedeepthroatSANmazakisakura kabinmother mazaSAN-023SAN023h-796san00023
    • 2021-11-16
    138 min

    [TEN-038]Yukemuri NAWA-KOKOKU 1 Rei Kurugi

  • satoshi kuruki censoredbdsmsingle workTENvan associatestenma harutenmaTEN-038TEN038h-859ten00038
    • 2021-12-09
    54 min

    FCP-058 [Delivery Only] Absolutely Subjective! !! Sperm Is Almost Exhausted! Super Feeling Good! !! Nipple Licking Handjob ＃ 6 (Natural Mizuki Hinata Rina Arisugawa Amane)

  • amateur censoredamateurbeautiful girlfcpfcp-058fcp058fcp-058
    • 2021-12-09
    128 min

    [FGAN-053]Club Uniform Girl Cosplay Fetish Video Yua Kawaei Yua

  • kawaei yui censoredschoolgirlsingle workFGANfechi mefetish eyesFGAN-053FGAN053h-1440fgan00053
    • 2021-12-10
    120 min

    [IPX-784]My Father-in-law Hates Me To Death, But His Favorite Food Is Me As A S********l... Minami Aizawa

  • minami aizawa censoredschoolgirlsingle workIPXidea pocketinaballdishIPX-784IPX784ipx00784
    • 2021-12-18
    71 min

    200GANA-2617 Seriously Nampa, First Shot. 1730 Picking Up An Erotic Woman Who Gets Fucked With A Guest At A Concafe! Extremely Narrow Paipanma ● The Sigh That Gradually Becomes Violent After Being Stabbed Is Erotic …

  • amateur censoredamateurganagana-2617gana2617200gana-2617
    • 2021-12-31
    123 min

    [ATID-493]Some Guy I Don"t Know Picked Up My Wife On A Trip She Went To With Her Lady Friends.

  • hikari ninomiya yuzu shirakawa censoredATIDattackersdragon nishikawain madATID-493ATID493atid00493
    • 2022-01-08
    160 min

    [GS-2036]Taboo. Sexual Awakening Of The Married Woman, 04 Continued. Please Sleep With My Wife, K (27 Years Old). 97

  • censoredmarried womanlesbianGSgostakeshi karakiGS-2036GS2036



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored