javcensored jav best omnibu censored creampie




FC2MIDEJUFESQTEKBISTARSWAAAPREDMILKVENXPPPDDASDCESDHMNAVSANACRHDKAWANZJULAPODCAWD

2020-11-22
49 min

FC2PPV 1579571 [Individual shooting] Please stop the innocent J system that you can not hide the tension with the first daddy active circle light! While saying that, the dick is an honest erotic girl! Selfishly conceived raw squirrel and vaginal cum

  • amateur uncensoredfc2
    • 2020-11-22
    123 min

    [HND-908]Karate Black Belt Short Haired Young Bride's First Raw Creampie To Help Her Practice For Baby Making Yua Yuzuki

  • yui yuki censoredcreampiebeautiful girlHNDhon nakamiyoshi rusherHND-908HND908hnd00908
    • 2020-11-26
    191 min

    [SVDVD-827]Limber-Limbed Tied Up Machine Vibrator Pleasure We Seduced A Real-Life Sports University College Girl Via Social Media, And She Turned Out To Be A Maso Bitch Who Wanted To Be Shamed, So We Made Her Dreams Cum True And Gave Her All The Craz

  • censoredSVDVDsadistic villagekannana dainanaSVDVD-827SVDVD8271svdvd00827
    • 2020-11-26
    53 min

    345SIMM-561 4 consecutive raw vaginal cum shot forbidden teachers and students!

  • amateur censoredcreampieuniformsimmsimm-561simm561345simm-561
    • 2020-12-01
    140 min

    [KIRE-012]A Thirty-Something Woman Can Raise Her Value Through Sex. Sumire Kurusu 30 Years Old Her Adult Video Debut

  • sumire kurusu censoredblowjobsingle workKIREsod createdainanabeauty kirei sodKIRE-012KIRE0121kire00012
    • 2020-12-03
    52 min

    H4610 ki201203 Shiori Uchimura 22years old

  • amateur uncensoredh4610
    • 2020-12-22
    73 min

    FC2PPV 1616189 Overwhelming Santa fluttered down on a holy night ❤️ I wasn’t told “I’m a present ♡”, but I returned plenty of sperm ~ ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-23
    16 min

    10musume 122320_01 Secret Pussy Collection: Rikako Yamada

  • amateur uncensored10musume
    • 2021-01-09
    402 min

    [KRU-103]Unreal Daydream Drama - Your Wish Has Come True! - "Time Stop!" - What Would You Do If You Could Stop Time？ - The Most Popular Girl In School And Your Beautiful Female Teacher Are Yours For The Taking! - Break Into School For Some Ti

  • censoredcreampiebig titsKRUkarmamanji groupKRU-103KRU103kru00103
    • 2021-01-16
    56 min

    H0930 tk0027 Izumi Tobe 32years old

  • amateur uncensoredh0930
    • 2021-01-23
    243 min

    [GS-2004]True Stories: Family Fun [TheBEST] 2019.10-2020. 04

  • censoredGSgosGS-2004GS2004h-101gs02004
    • 2021-01-29
    44 min

    FC2PPV 1664536 Infiltrate a secret orgy ㉕ G-cup big breasts wear bloomers that are unbearable for the Ossan generation ♪ Creampie festival ♪ * High-quality version & review benefits included [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-02
    124 min

    [ARM-949]My Cousin's Grown Into A Smoking Hot Slut？! Coating Her Lower Half In Cum While She's Still Wearing Her Panties Tsukino Okawa

  • okawa tsukino censoredsingle workARMaroma planninghamu oujiaromaARM-949ARM949arm00949
    • 2021-02-18

    FC2PPV 1691556 Limited time [Uncensored] Night date with sensitive apparel clerk, continuous vaginal cum shot (64 minutes)

  • amateur uncensoredfc2
    • 2021-02-19
    115 min

    [DDFF-007]High-Class Female Sub Parlor - Breaking In Masochists With G*******g Sex And Face Fucks - VIP Course Miki Maeshima

  • miki maejima censoreddeepthroatsingle workDDFFdogmafk 2DDFF-007DDFF007ddff00007
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-27
    244 min

    [MCSR-428]The Melancholoy Of A Beautiful Mature Woman In Mourning - Immoral Widow Babes - 5 Ladies 4 Hours

  • hitomi enjo yuki arai censoredmature womanMCSRbig morkalsaburo kamegashimamascottMCSR-428MCSR42857mcsr00428
    • 2021-03-17
    75 min

    [opcyn-161]まお(21)

  • amateur censoredamateuropcynopcyn-161opcyn161opcyn-161
    • 2021-03-26
    59 min

    [WKD-040]A Woman's Fall Yuri Honma

  • really censoredbig titsslutWKDwaap entertainmentk westwWKD-040WKD0402wkd00040
    • 2021-03-29
    57 min

    292MY-431 Anri Shinomiya

  • amateur censoredbig titsmarried womanmymy-431my431292my-431
    • 2021-04-21
    291 min

    [HOISW-004]Sweet! Champion 4 - Bad Girl's Passionately Erotic Corruption! Delinquent, POV, Self-Shot, Amateur, Beautiful Girl, Pouty, Big Tits, Beautiful Tits, Cum Swallowing

  • censoredbig titsamateurHOISWfresh gordon mousouzokufresh gordonHOISW-004HOISW004hoisw00004
    • 2021-04-24
    96 min

    [VENX-031]When Her Stepson Creampie Fucks Her, She'll Clean Him Up With A Blowjob, And Then Get Him Rock Hard Again So He Can Pump Her Pussy And Empty His Balls Out In An Endless Loop Of Shameful Fucking Sayuri Mitsumoto

  • sayuri mitsumoto censoredcreampiebig titsVENXvenussarufakecest winntersVENX-031VENX031venx00031
    • 2021-05-04
    145 min

    [SDMM-089]The Magic Mirror Number Bus Massage Parlor Therapists Only "Would You Give Us A Testicular Massage？" 4 Kind And Gentle Amateur Babes Who Delicately And Thoughtfully Massaged These Men's Balls Because They Were Suffering From Imp

  • censoredamateurhandjobSDMMsod createanzomagic mirrorSDMM-089SDMM0891sdmm00089
    • 2021-05-08
    144 min

    [REAL-768]Impregnating And Cumming Inside S********ls 20 Times Mitsuki Nagisa

  • scooping censoredcreampieschoolgirlREALk m producetorendei yamaguchireal real worksREAL-768REAL768real00768
    • 2021-05-14

    FC2PPV 1816869 Limited number [Uncensored] Locally quiet professional students were nasty when they took off their glasses … Stripped off the mask and made vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-05-14
    145 min

    [ROYD-054]This Former Horny Homeroom Teacher Is Cumming And Convulsing So Hard! My Son Is A Monster Of Sexual Desire, You See... Risa Hasegawa

  • risa hasegawa censoredcreampiebig titsROYDroyalmorikihhh groupROYD-054ROYD054royd00054
    • 2021-05-20
    181 min

    [OFKU-182]This Colossal Tits Housewife Had Voluptuous, Big Saggy Tits, And She Fell For His Young Cock As They Engaged In Creampie Sex 180 Minutes

  • censoredbig titsmature womanOFKUstar paradisemom railOFKU-182OFKU182h-254ofku00182
    • 2021-05-21
    116 min

    [JUL-574]I'll Never Tell My Wife About How I Knocked Up My Mother-In-Law... I Threw Caution To The Wind Out Of Lust And Had Creampie Sex On Our One-Night, Two-Day Hot Spring Vacation. Ai Kano

  • ai kano censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-574JUL574jul00574
    • 2021-05-21
    155 min

    [JUL-585]I Was Made To Cum Over And Over By My Son's Friend's Uncontrollable Adulterous Fucking... Momoko Isshiki

  • momoko isshiki censoredbig titsmature womanJULmadonnaamazing meatJUL-585JUL585jul00585
    • 2021-06-04
    122 min

    [UMD-781]A Fresh Face Office Lady Who Was Targeted During The Company Trip 2

  • himari kinoshita himari hanazawa nana maeno censoredUMDleodragon nishikawaUMD-781UMD781125umd00781
    • 2021-06-10
    107 min

    [FGAN-042]My Very Own Panty Shot Doll Hinako

  • censoredcosplayFGANfetish eyesFGAN-042FGAN042h-1440fgan00042
    • 2021-06-11
    141 min

    [MUDR-150]Adolescent Cuckholding My Girlfriend Was Fucked By An Unknown Older Man... Miruku Himeno

  • himeno milk censoredcreampieuniformMUDRmukuMUDR-150MUDR150mudr00150
    • 2021-06-26
    160 min

    [LULU-079]This Beautiful Wedding Planner Gave The Groom A Deep Throat 3D Blowjob That He Could Never Get From His Wife, And Showed Off Her Amazing Technique In A Display Of Her Powerful Cum Swallowing Semen-Sucking SK**ls Yumi Saeki

  • yuka saeki censoredcreampiesingle workLULUlunaticsvagmanLULU-079LULU079lulu00079
    • 2021-07-09
    118 min

    [EBOD-841]When Mother's Not Around... Big Tits Hostess Repeatedly Made to Cum During Coronavirus Crisis by Fat Customer's Peerless Dick... Mina Kitano

  • mina kitano censoredcreampiebig titsEBODe bodykitorune kawaguchiEBOD-841EBOD841ebod00841
    • 2021-07-10
    156 min

    [MKMP-406]I was Continually and Single-Mindedly Fucked by Akari Nimura with my Back to the Setting Sun Melting into the Sky

  • akari shinmura censoredcreampieslutMKMPk m producesamoarimillionMKMP-406MKMP406mkmp00406
    • 2021-07-15
    60 min

    C0930 ki210715 Ayako Matsuzaki 49years old

  • amateur uncensoredc0930
    • 2021-07-17
    153 min

    [CAWD-249]Modest And Quiet, But I Love Sex ... Natsu Hinata's Extreme Coming x 2! 3 Penetrations

  • natsu hinata censoredsquirtingbeautiful girlCAWDkawaiimichiru arashiyamCAWD-249CAWD249cawd00249
    • 2021-07-29
    61 min

    336KNB-165 An Immoral Married Woman Who Applied For AV With Interestingness Exposing Her Plenty Of Body, Shaking Beautiful Big Tits And Disturbed With Other Sticks! I Will Take A Gonzo With This Married Woman From Now On. 58 At Kisarazu Station, Kisa

  • amateur censoredbig titsmarried womanknbknb-165knb165336knb-165
    • 2021-08-06
    124 min

    [MIAA-482]Training Camp G*******g - Cute Female Manager Takes A Creampie From Every Member Of Her Team Until Her Pussy Gushes Cum Natsu Tojo

  • natsu tojo censoredcreampiedeepthroatMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-482MIAA482miaa00482
    • 2021-08-14
    43 min

    404DHT-0094 An Unabated E-Cup Past The Fifty! Yuri 55 Years Old

  • amateur censoredbig titsamateurdhtdht-0094dht0094404dht-0094
    • 2021-08-17
    27 min

    FC2PPV 2036352 [Beach 〇 Wave Very Similar, Individuality, Long Tongue, God Tech Non-Stop Continuous Mouth Firing] God Tech Blowjob With Sailor Costume Of Small Devil Slut Airi! Pour Muddy Semen Into A Wine Glass With Moe Faint In Agony And Toast!

  • amateur uncensoredfc2
    • 2021-09-03
    178 min

    [DVDMS-708]A Clear Beauty That Charms Men. Former Entertainer Mika Kisaragi, 29, "I"m going to be a married woman soon". Debuted In Porn Without Telling Her Fiance

  • mika kisaragi censoredsingle workDVDMSdeepsbiba gonzoDVDMS-708DVDMS708dvdms00708
    • 2021-09-17
    100 min

    FC2PPV 2211974 [* Until It Disappears *] 30000pt → 2980pt [1 Hour 39 Minutes] [Appearance] [Uncensored] A Natural Amateur Girl Blows A Big Dick From The Camera’s Eyes Or Gets Fucked In The Missionary Position Etc …

  • amateur uncensoredfc2
    • 2021-09-17
    160 min

    [MIDE-971]A Super Lewd Girl Speaking A Dialect Gets You Off: Prostitution Residence - Kibo Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyztorendei yamaguchimoodyz divaMIDE-971MIDE971mide00971
    • 2021-09-24
    205 min

    [HUNTB-102][What Are You Doing？! I Wanted My Girlfriend To Pop My Cherry!] A Perverted Younger Step-Sister Barging Into Her Step-Brother"s Room To Steal His Virginity

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-102HUNTB102huntb00102
    • 2021-09-25
    120 min

    [BLB-011]Big Black Dicks A Japanese Beauty Gets Fucked All It Took Was A Little Debt And A Lie To Destroy Her Life ... A Married Woman Is Continuously Betrayed Until She Descends Into The Depravity Of A Four-Way G*******g Hell Mao Hamasaki

  • hamazaki mao censoredmature womansingle workBLBglobal media entertainmentsadoshima jiroublack beastBLB-011BLB011blb00011
    • 2021-10-16
    69 min

    SIRO-4654 [First Shot] [Clear Soft Skin] [Sss-Class Beautiful Girl] A Beautiful Therapist With A Beautiful Appearance And Curvaceous Beauty Without Blind Spots Has Arrived. When She Is Relentlessly Blamed For Her Transparent And Supple Body, She Is I

  • amateur censoredamateurbeautiful girlsirosiro-4654siro4654siro-4654
    • 2021-10-23
    164 min

    [GENM-092]An Illusionary Going Out for a Drive, Yuki Yoshizawa

  • yuki yoshizawa censoredbig titsbeautiful girlGENMgenekig3GENM-092GENM092genm00092
    • 2021-11-06
    69 min

    H0930 ki211107 Yuri Nonoda 30years old

  • amateur uncensoredh0930
    • 2021-11-11
    220 min

    [ABW-165]美少女と、貸し切り温泉と、濃密性交と。 16 絶対的美少女を一泊貸し切り、山奥の温泉宿へ… 松岡すず【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurabwabw-165abw165abw-165
    • 2021-11-30
    19 min

    FC2PPV 2477398 Second Visit [Individual] Visited My Wife’s Beauty Witch At Home After Shopping. Before Her Husband Returns Home, She Sucks The Juice Of Another Person Into The Womb In The Back Of Her Vagina With Her Other Stick And Conceives It.

  • amateur uncensoredfc2
    • 2021-12-03
    124 min

    [ADN-356]It"s Almost Been 5 Years Since This Horny Father-In-Law Started Sexual Relations With A Son"s Wife Iroha Natsume

  • natsume saiharu censoredcreampiesingle workADNattackersdoragon nishikawaotona no dramaADN-356ADN356adn00356
    • 2021-12-25
    138 min

    [CEMD-103]This Morning, When I Woke Up, I Had Become My Favorite Girl! Shizuku Asahi I Was A Big Fan Of Shizuku Asahi, So, In Any Case, I Decided To Start Playing Pranks On Her Tinny Titties And Her Sweet Little P*ssy!

  • asahi drop censoredcreampiemature womanCEMDceleb no tomoCEMD-103CEMD103cemd00103
    • 2021-12-31
    34 min

    FC2PPV 2553598 First Shot! !! Limited Number! [Uncensored] Love Juice That Overflows Every Time It Is Struck, A Lewd Voice And A Gaze … Creampie Twice To A Beautiful Ecup Beauty With A Korean Wave Half! !! It Was Horny With Clear And Beautiful S

  • amateur uncensoredfc2
    • 2022-01-06
    109 min

    [AARM-050]Lap Up Her Nipples And Squeeze Your Cock With Her Tight Ass While She Swoons - Edged Until She Lets You Blow Your Load On Her Thighs

  • akari shinmura erika sasanami censoredAARMaroma kikakukadowaki shigeoaromaAARM-050AARM050aarm00050
    • 2022-01-07
    120 min

    [SSIS-288]All The Customers Are Lusting After The Wife"s Erotic Body... Saki Okuda, A Part-time Married Woman At The Super Public Bath Of Yasuragi.

  • saki okuda censoredbig titsmarried womanSSISs one number one stylemamezawa mametaros1 no 1 styleSSIS-288SSIS288ssis00288



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored