javcensored mini system petite jav censored




FC2FSDSSSDABDTTSSISMVSDCAWDSQTECESDATIDMEYDMIDVONEZSTARSHMNBLKWANZIPXHUNTBJULROYD

2020-11-13
138 min

[QRDA-118]Pervert Queen's Addicting Pleasure - Akane

  • censoredanalQRDAqueen roadQRDA-118QRDA118qrda00118
    • 2020-11-29
    79 min

    [BAB-017]This Lingerie Shop Girl Wanted Some Raw Sex

  • censoredbig titsblowjobBABbabylon daydreamersBAB-017BAB017bab00017
    • 2020-12-03
    36 min

    FC2PPV 1592695 ☆ ★ Discount for a limited time ★ ☆ Creampie for Peco ○ Nu-chan of Pricone! De M Princess’s ahegao is erotic!

  • amateur uncensoredfc2
    • 2020-12-11
    122 min

    [GS-1999]Perverted Massage Clinic 96

  • censoredGSgosGS-1999GS1999h-101gs01999
    • 2020-12-12
    60 min

    Caribbeancom 121220-001 Grab and squeeze my boob! Yukie Natsuki

  • yukie natsuki uncensoredcreampiecaribbeancom
    • 2020-12-21
    85 min

    [ZOZO-032]Minami Saitou

  • minami saito censoredZOZOsadistic villageZOZO-032ZOZO0321zozo00032
    • 2020-12-25
    30 min

    359TYVM-116 Norika

  • amateur censoredcreampiebig titstyvmtyvm-116tyvm116359tyvm-116
    • 2020-12-26
    123 min

    [SWDF-007]アソコに直穿きスポウェア女子 マン肉クチュクチュ濡れすぎボディでエクササイズ！！

  • marina yuzuki toua kotone censoredsquirtingSWDFoyster kaiunswordfishSWDF-007SWDF007h-1359swdf00007
    • 2021-01-08
    568 min

    [MIST-324]At "An Old Traditional Titty Pub" In The Biggest Entertainment District In Japan, Your Favorite Girls Will Fuck You Raw With Cowgirl Sex Until You Creampie Ejaculate Highlights 2-Disc Set 567 Minutes 2

  • sayumi yamai inaba censoredcreampiebig titsMISTmr michirusaitaMIST-324MIST3241mist00324
    • 2021-01-24
    120 min

    [AGAV-047]This Natural Airhead Lolita Babe Has The Greatest I-Cup Colossal Tits I Oiled Up This Fully Clothed Princess' Titties And Satisfied Myself From All Angles And Now My Life Is Complete Hana Himesaki

  • himesaki hana censoredbig titsblowjobAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-047AGAV047agav00047
    • 2021-01-24
    36 min

    285ENDX-325 Pinch the nipple strongly! Frustration is here with an unstoppable hip swing! Eliminate as soon as possible! ？？ Firm hold SEX!

  • amateur censoredcreampieamateurendxendx-325endx325285endx-325
    • 2021-02-15
    245 min

    [NPS-409]Real Pickup! Adorable Girl's First-Ever Orgasm From A Raw Cock! Hip-Shaking Orgasms She'll Remember - The Shudders Won't Stop! 17 Loads! 136 Climaxes!

  • censoredcreampiesquirtingNPSpetersken kikuchinampaNPS-409NPS409h-021nps00409
    • 2021-02-28
    77 min

    300NTK-527 Echi Echi area development! !! H cup beauty x GAL x tide = the strongest P active women’s round begins! !! Negotiations struggle with firm greedy professional P girls! ？？ The weak point is squirting Ma Ko who is too binkan! !! The tot

  • hpnn censoredcreampiebig titsntkntk-527ntk527300ntk-527
    • 2021-03-06
    157 min

    [JUL-487]A Woman With Beautiful Golden Legs - Yuna Kitano, AV DEBUT!!

  • yuna kitano censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-487JUL487jul00487
    • 2021-03-06
    62 min

    Caribbeancom 030621-001 Beautiful Bride – Creampie SEX on the eve of the wedding with the staff Miyuki Sakura

  • miyuki sakura uncensoredcreampiehandjobcaribbeancom
    • 2021-03-09
    49 min

    FC2PPV 1719198 * Limited time 3980⇒2980pt ★ Super rare amateur ☆ Lori girl Mayatan 19 years old re-advents in a nasty maid! ☆ Decaprickets are addictive ♥ Electric Maiki ♥ Rich intense blowjob ♥ Gun thrusting into the finest pussy ♥ [Personal shootin

  • amateur uncensoredfc2
    • 2021-03-14
    61 min

    200GANA-2453 In the spear room of the Nampa master of 100 battles, a senior woman fell asleep during a card game betting on "undressing" … Senior woman and I in a camisole left behind. When I couldn’t stand this temptation and terri

  • amateur censoredamateurganagana-2453gana2453200gana-2453
    • 2021-03-18
    119 min

    [TPPN-186]Hot Newcomer's First Descent Into Porn! First Time Light Skin Amateur Takes Loads Of Cum On The Face As She Writes And Screams In Sexy Pleasure 11 Cum Shots

  • censoredamateurbukkakeTPPNteppanTPPN-186TPPN186tppn00186
    • 2021-03-20
    61 min

    HEYZO 2481 Masochistic Slut -Married Bitch Giving Her Husband The Cold Shoulder- – Rena

  • rena uncensoredcreampieheyzo
    • 2021-03-26
    90 min

    300NTK-541 Echi Echi H Cup Sensitive Beauty Is An AV Mania! ？？ Echimuchi busty squeezing promotion body is super binkan! !! A tech co-star who is inevitable to have an AV actor outburst with the total mobilization service of erotic tech unique to man

  • amateur censoredcreampiebig titsntkntk-541ntk541300ntk-541
    • 2021-03-27
    119 min

    [MRSS-109]"Let's Go To The Aquarium Again Next Year..." My Beloved Wife Signed Up To Be A Cum Receptacle For A Rich Family For A Year To Make Money For My Son's Surgery Yu Shinoda

  • shinoda yu censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-109MRSS109mrss00109
    • 2021-03-27
    117 min

    [XVSR-586]

  • rumi tadami censoredcreampiebig titsXVSRmax aikuzo yoshidacalenXVSR-586XVSR586xvsr00586
    • 2021-04-09
    156 min

    [JUFE-280]My Special Summer Vacation With My Teacher... Beautiful Y********l In Uniform With H-Cup Tits Takes Middle-Aged Sperm Nenne Ui

  • first love censoredbig titssquirtingJUFEfitchJUFE-280JUFE280jufe00280
    • 2021-04-16
    85 min

    383REIW-059 Yukino

  • amateur censoredamateurreiwreiw-059reiw059383reiw-059
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-26
    54 min

    FC2PPV 1837582 Satomi Ishihara ● Enjoyed the super beautiful 19-year-old god milk that looks like

  • amateur uncensoredfc2
    • 2021-05-28
    31 min

    359TYVM-160 Cheating Sex In Work Uniform! ？？ Mass seeding of a horny wife working at a department store! !!

  • amateur censoredcreampiemarried womantyvmtyvm-160tyvm160359tyvm-160
    • 2021-06-11
    120 min

    [MUDR-152]Ever Since That Day... Beautiful Y********l In A School Uniform Is Tied Up, Trained, And Filled With Cum Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiebdsmMUDRinnocentMUDR-152MUDR152mudr00152
    • 2021-06-16
    247 min

    [DVDMS-672]A Normal Boys And Girls Focus Group Adult Video These Male And Female Colleagues Are Locked In A Room And They Won't Be Let Out Until They Can Produce 20ml Of Semen! In Order To Get Their Male Colleagues To Cum, These Female Employees

  • censoredcreampiebig titsDVDMSdeep ssuttorune iwanagaDVDMS-672DVDMS672dvdms00672
    • 2021-06-24
    115 min

    [SPRD-1429]Stepmom/Stepson - Stepson's First Creampie Is In His Stepmom Arisa Shitara

  • shidara arisa censoredcreampiemomSPRDtakara eizokyuta tukumoaleddinSPRD-1429SPRD142918sprd01429
    • 2021-06-26
    93 min

    FC2PPV 1888253 Prefectural ③ 148cm 39kg　-limited quantity-

  • amateur uncensoredfc2
    • 2021-06-26
    119 min

    [VEO-044]Authentic Amateur Porn Debut! Real Life Piano Teacher Goes Crazy Shaking Around Her Huge Bouncy G-Cup Tits Ayaka Morimoto

  • ayaka morimoto censoredcreampiebig titsVEOvenuspeterbornVEO-044VEO044veo00044
    • 2021-07-03
    140 min

    [PKPD-152]Sugar Baby Creampie Job Search Rui Sucks Cock With Her Plump Lips In Return For Money Rui Komatsu

  • komatsu rui censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-152PKPD152pkpd00152
    • 2021-07-07
    28 min

    FC2PPV 1909165 Up to 14 [Individual] A beautiful-faced wife who lost her new home. The body is tossed by a virgin and it is violated by two strange sticks and it is in a state of daze

  • amateur uncensoredfc2
    • 2021-07-16
    72 min

    383REIW-082 Naru

  • amateur censoredbig titsamateurreiwreiw-082reiw082383reiw-082
    • 2021-07-16
    66 min

    518ASGM-011 [Daddy Activity Jk / Intravaginal Ejaculation] Big Breasts Beautiful Girl (public / Ordinary Course / Back Option Available) J Cup

  • amateur censoredcreampiebig titsasgmasgm-011asgm011518asgm-011
    • 2021-08-09
    48 min

    274DHT-0093 Picking Up A Beautiful Witch In Forty Who Is Too Perfect On The Street! !! Hikari 47 Years Old

  • amateur censoredmarried womanamateurdhtdht-0093dht0093274dht-0093
    • 2021-08-12
    198 min

    [SVDVD-870]Shame! Outdoor Knee Buckling! Had Big Bang Vibrator In Her Pussy For Squirting Climax During Date! 20 Rin Miyazaki

  • miyazaki rin censoredcreampiesquirtingSVDVDsadistic villagetoranosukeshuuchi musumeSVDVD-870SVDVD8701svdvd00870
    • 2021-08-13
    189 min

    [HUNTB-085]"Well, The Two Of You Seemed So Happy ..." Horny Nurse After Nurse, Engaged In Irreversibly Damaging Reverse NTR Filthy Sex! I Went To Be With My Wife In The Hospital During Her Pregnancy, When I Met All These Beautiful Nurses ...

  • censoredcreampieuniformHUNTBhunterkawajirihhh groupHUNTB-085HUNTB085huntb00085
    • 2021-08-17
    152 min

    [SDJS-124]Firs Creampie, Semen In Her Pussy Until Morning In The Hotel On The Way Home From Work... Kotoha Nakayama

  • nakayama kotoha censoredcreampiesoloworkSDJSsod createyazawa reshi busod jouko shainSDJS-124SDJS124
    • 2021-09-04
    54 min

    292MY-492 Kobayashi Biya 2

  • amateur censoredcreampiebig titsmymy-492my492292my-492
    • 2021-09-05
    115 min

    [083PPP-2232]近●相姦トライアングル(8)～義母とその妹に挿入したい息子

  • amateur censoredbig titsamateurpppppp-2232ppp2232083ppp-2232
    • 2021-09-08
    111 min

    241GAREA-520 Hina

  • amateur censoredamateurbeautiful girlgareagarea-520garea520241garea-520
    • 2021-09-18
    65 min

    C0930 ki210919 Norika Shimokawa 21years Old

  • amateur uncensoredc0930
    • 2021-09-23
    124 min

    [HAVD-1012]Kissing All The Time! Can"t Stop Cumming! Dirty Lesbian Sex Who Love Each Over A Lot

  • waka ninomiya nagatsuki natsuki censoredlesbianHAVDhibinodr torihamaHAVD-1012HAVD10121havd01012
    • 2021-10-01
    133 min

    [NACR-470]This Beautiful Girl Is Hunting For Sugar Daddies And Loves To Tweak Nipples And Lick Bodies Up And Down With Slobbering Foreplay!! Noa Miura

  • miura noai censoredcreampiebig titsNACRplanet plushimurokkushichi ku ryuuNACR-470NACR470h-237nacr00470
    • 2021-10-08
    60 min

    FC2PPV 2314672 * Until 10/10 3980⇒2980 ★ First Shot ☆ 147cm Mini Small Breasts Loli Body ♥ Cute Bishoujo Harupyon 18 Years Old ☆ Excellent Sensitivity! Geki Iki Squirting Pussy ♥ Big Cock Is Thrust Into A Small Body And Faint In Agony Iki Rolled Vagi

  • amateur uncensoredfc2
    • 2021-10-21
    123 min

    [FSDSS-343]Fresh Face Practically A Virgin But Strongly Curious About Sex Mayu Horizawa AV Debut

  • mayu horizawa censoredbig titsblowjobFSDSSfalenomaeda tomonorifaleno starFSDSS-343FSDSS3431fsdss00343
    • 2021-10-29
    116 min

    [SHKD-970]A High-Class Private Tutor Gets Fucked. Michiru Kujo

  • kujo michiru censoredsingle workSHKDattackershaga eitaroushi yoru akuSHKD-970SHKD970shkd00970
    • 2021-11-03
    56 min

    416SVMM-056 Mizuki (Natural Mizuki)

  • amateur censoredcreampiesquirtingsvmmsvmm-056svmm056416svmm-056
    • 2021-11-12
    74 min

    529STCV-032 [Sperm Sommelier] Slender Beautiful Girl J System And Kneading! Rich Sex With "A" Who Is A Metamorphosis Who Is Particular About The Taste Of Sperm! I Research Ochin ● Every Day In Search Of Delicious Sperm. Today’s Sperm Was

  • amateur censoreduniformschoolgirlstcvstcv-032stcv032529stcv-032
    • 2021-11-13
    114 min

    [DDHZ-013]Woman Addicted to Confinement, A Claustrophobic Business Woman, Riona Hirose

  • rio hirose censoredsingle workDDHZdogmano maru kimore no hitodzumaDDHZ-013DDHZ013ddhz00013
    • 2021-12-04
    129 min

    [RPIN-058]This Doe-Eyed Big Ass Elder Sister Type Is A Beautiful Massage Parlor Therapist Who Loves To Sock Cock, And Now She"s Descending Into Hot, Buttery Pleasure Through An Erotic Massage And A Big Dick!

  • censoredamateurRPINrikopin mousozokuoozora kakeruRPIN-058RPIN058rpin00058
    • 2021-12-13
    98 min

    116SHN-071 Sensitive Nipple Flirting ● 2022 J ○ Who Was Mischievous By An Ambulance Being Transported / JD Who Was Fucked In A Taxi

  • amateur censoredschoolgirlamateurshnshn-071shn071116shn-071
    • 2021-12-15
    28 min

    FC2PPV 2518531 A Slender Gal Of A Tekiya. "Put In" And Begging For "Ikuiku" Barrage And Vaginal Cum Shot * Limited To 100 Year-End Specials

  • amateur uncensoredfc2
    • 2021-12-25
    132 min

    [APNS-269]Targeted Running Girl. "Running Around Dressed Like That Is Asking To Get Fucked (lol)" Kiu Aihara

  • aihara tsukiha censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-269APNS269apns00269



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored