javcensored planning big tits jav




FC2SPRDCESDBLKMEYDONEZADNSDABAMBISHKDDASDCAWDFSDSSHDKAMARAMVSDSQTEIPXVENXKBINNPJ

2020-11-12
125 min

[FSDSS-123]Excited Squirting * And Peeing (Heart) Intercourse * Mayoi Arisaka

  • arisaka mayoi censoredbig titssquirtingFSDSSfalenocaptain eharafaleno starFSDSS-123FSDSS1231fsdss00123
    • 2020-11-22
    49 min

    1Pondo 112220_001 Model Collection: Emi Aoi

  • amateur uncensored1pondo
    • 2020-11-24
    93 min

    451HHH-013 AV first experience [mochi mochi beautiful skin] [thighs you want to bury] [sensitive second wet] Moderate flesh and super sensitivity! Throw in the body optimized for sex from the front to the back and make a vaginal cum shot & facial

  • amateur censoredcreampiesquirtinghhhhhh-013hhh013451hhh-013
    • 2020-11-26
    174 min

    [SW-739]"You Can't Get Hard For Your Own Stepdaughter, Can You？!" My Stepdaughters Keep Flashing Their Panties And Making Me And Their Stepbrothers' Dicks Throb - These Horny Brats Want To Gobble Cock Behind Their Mama's Back!

  • censoredSWswitchyocchanswitch switchSW-739SW7391sw00739
    • 2020-12-13
    95 min

    [NSPS-950]My Wife Got G*******ged 12 - The Baby In Her Belly's Probably Not Mine... Ayane Yuki

  • ayane yuki censoredmature womansingle workNSPSnagae stylenagaeNSPS-950NSPS950nsps00950
    • 2021-01-11
    96 min

    428SUKE-056 [Special H-Cup Sister] Borrow a mobile battery and have a nurse cabaret and Pakopako SP! !! Foul-class beauty style with big breasts and constriction! Catch your boobs with a nipple rotor! Sensitive Ma ● Ko is an etch disinfectant tide in

  • amateur censoredcreampiebig titssukesuke-056suke056428suke-056
    • 2021-01-12
    118 min

    [STARS-319]All Alone With My Hot Employee, Everyone Else Is Working From Home. She's Got A Boyfriend... But She Doesn't Seem To Mind. Fucking From Nine To Five, Then Some Overtime. Forget About Your Deadlines With Incredible Multiple Back-To-

  • asahina nanase censoredsingle workdramaSTARSsod createkirinsod starSTARS-319STARS3191stars00319
    • 2021-01-14
    150 min

    [NTRD-086]Cuckolders With My Subordinate... Miya Tanaka

  • miya tanaka censoredmature womansingle workNTRDtakara eizokouji takarashintokaiNTRD-086NTRD08618ntrd00086
    • 2021-01-21
    240 min

    [SVDVD-838]Shame! A Newly Appointed Nurse Takes A Medical Examination Before Being Assigned To Her New Post 2021 We Were Experimented On By The Resident Doctors

  • ayaka mochizuki honoka wakamiya censoredcreampienurseSVDVDsadistic villageista girl and her shameSVDVD-838SVDVD8381svdvd00838
    • 2021-01-24
    27 min

    FC2PPV 1657528 Until 27th 2480pt → 1980pt [Personal shooting] Beautiful office lady at the reception desk of the company ・ Because the repayment period has expired, four other sticks will receive interest in the car.

  • amateur uncensoredfc2
    • 2021-02-05
    53 min

    FC2PPV 1673806 [Big breasts sister] Orgy out in a house! Hcup Boyne milk hanging and straddling a man Porcio convulsions big cum ♥ Raw Saddle personal shooting party until morning [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-05
    60 min

    [PARATHD-3096]Picking Up Girls Who Came To Tokyo On An Overnight Bus (2) - Meari From Hiroshima (24)

  • censoredbig titsamateurPARATHDparadise tvPARATHD-3096PARATHD3096parathd03096
    • 2021-02-06
    244 min

    [DVDMS-629]Ordinary Guys & Girls Caught On Camera - College Girl Amateurs Only - Platonic Friends Build Up To 20 mL Of Pent-Up Cum Behind Closed Doors! 6 - Shy College S*****t Amateur Babes Give Their Male Friends Handjobs, Jerk Them Off With Fles

  • censoredcreampiebig titsDVDMSdeep sgreenhouse effectDVDMS-629DVDMS629dvdms00629
    • 2021-02-07
    96 min

    345SIMM-605 Good glue, good face, good sensitivity! Secret special training on the bed with spokon J ○ ♪♪ Eat a lot and radiate the replenished energy with etch! !! Uncle sperm injection is completed in the energetic Hatsuratsu beauty Ma ○ Ko who ded

  • amateur censoredcreampieuniformsimmsimm-605simm605345simm-605
    • 2021-02-16
    130 min

    [MSFH-050]When The Attendance Rate At The Office Plummeted, I Found Myself Alone With My Lady Boss ... And When She Realized That My Pants Were Bulging (I'm A Cherry Boy), She Lured Me To Creampie Sex, And We Ended Up Fucking Like Crazy Until My

  • rio hirose censoredcreampiesingle workMSFHsod createkirinms sodMSFH-050MSFH0501msfh00050
    • 2021-02-28
    124 min

    [JJBB-006]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 06

  • censoredcreampiemature womanJJBBjukujo japanJJBB-006JJBB006jjbb00006
    • 2021-03-04
    58 min

    FCP-002 [Delivery only] Completely subjective! !! G cup or more that completely wraps Ji ● Ko … Superb big tits fucking ＃ 2

  • amateur censoredbig titsamateurfcpfcp-002fcp002fcp-002
    • 2021-03-04
    123 min

    [AKDL-091](Rei, Age 21, Wants To Be A Voice Actor And Has Explosive Orgasms) She's Been In The City For 1 Year, She's Slept With 8 People - This Sweet, Relaxing Cutie Feels Comfortable To Be Around (A Full Course Of Lusty SEX) Ear-Licking, Ho

  • censoredsquirtingamateurAKDLaquinoriaquinoriaknrAKDL-091AKDL0911akdl00091
    • 2021-03-05
    140 min

    [YMDS-022]Lovey-Dovey, Hard And Tight Sex The Day Asuka Momose Became My Girlfriend

  • momose asuka censoredcreampieblowjobYMDSmomotaro video publishingyoung peachYMDS-022YMDS022ymds00022
    • 2021-03-20
    157 min

    [ARMG-289]Smiling Blowjob

  • censoredblowjobbeautiful girlARMGaroma planningshigeo kadowakiaroma g 18ARMG-289ARMG289armg00289
    • 2021-04-08
    127 min

    [MEKO-208]New "Rental MILF" Service 11 - They Say You Can Give Them A Creampie So We Tried Asking For Even More Extreme Services

  • censoredcreampieamateurMEKOmature woman laboMEKO-208MEKO208h-1160meko00208
    • 2021-04-14
    120 min

    [ARM-970]The Impulse To Stick Your Face Into A Set Of Thighs, The Desire To Be Corrupted By Having Your Face Squeezed In Between A Set Of Thighs

  • hebei haruna yamamoto renka censoredhandjobARMaroma planninghamu oujiaromaARM-970ARM970arm00970
    • 2021-04-18
    27 min

    FC2PPV 1776135 [4K] [Individual shooting] Suzu-chan 20 years old part19 4K version part 4

  • amateur uncensoredfc2
    • 2021-04-24
    137 min

    390JAC-087 [Series’ first gal home x 5 vaginal cum shots] Kawaii JAPAN representative! Creampie hat trick from continuous cum assist! Sergio ● Even after that, I was surprised at the continuous tide! Little HONDA also muttered “This gal is

  • japan censoredcreampiesquirtingjacjac-087jac087390jac-087
    • 2021-04-29
    62 min

    336KNB-152 Sexless For 2 Years And A Big Explosion Of Desire! !! Mysterious husky voice erotic wife is disturbed as she desires dense sex! !! I will take a gonzo with this married woman from now on. 45 at Higashiurawa Station, Saitama City, Saitama P

  • amateur censoredcreampiemarried womanknbknb-152knb152336knb-152
    • 2021-05-01
    108 min

    [ID-031](Ear-Plugged Sex) I Ordered A Female S*****t Delivery Health Call Girl And She Turned Out To Be A Boyish Slut (My Beloved Delivery Health Call Girl) Nanami Ozora

  • sena ai censoredcosplaybeautiful girlIDtmaID-031ID0315526id00031
    • 2021-05-01
    118 min

    [AMBI-125]My Secret Love Life With My Homeroom Teacher Mashiro Kisaragi

  • kisaragi mashiro censoredschoolgirlbeautiful girlAMBIplanet plusdirector oanbibaresotsuAMBI-125AMBI125h-237ambi00125
    • 2021-05-05

    FC2PPV 1767822 [Personal shooting] Ai 20 years old Blow & Handjob Remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-05-26
    54 min

    FC2PPV 1837582 Satomi Ishihara ● Enjoyed the super beautiful 19-year-old god milk that looks like

  • amateur uncensoredfc2
    • 2021-06-17
    121 min

    [MKON-055]My C***dhood Friend Who Has A Stalker Asked Me To Be Her Bodyguard When She's Leaving School Natsu Tojo

  • natsu tojo censoredcreampieschoolgirlMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-055MKON055mkon00055
    • 2021-06-18
    73 min

    [SS-026]Lovin' You Yu Shinoda

  • ai uehara yoshinaga akane censoredcreampiebig titsSSplumSS-026SS02613ss00026
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    154 min

    [CEMD-023]Yui Hatano Goes Picking Up Girls For Lesbian SEX In The Street! Wanna Try Some Girl On Girl...？ vol. 2

  • yui hatano censoredamateurlesbianCEMDceleb no tomoCEMD-023CEMD023cemd00023
    • 2021-06-24
    61 min

    1Pondo 062421_001 Home visit sexual intercourse with a teacher Rino Sakuragi

  • amateur uncensored1pondo
    • 2021-06-25
    45 min

    FC2PPV 1887907 [Uncensored] G-cup busty beauty esthetician Ami-chan has a vaginal cum shot copulation !!: Esthetician: Ami-chan (24 years old)

  • amateur uncensoredfc2
    • 2021-07-23
    192 min

    [YRLL-005]The Two Female Office Workers With The Beautiful Legs: They Are Lesbians Who Love To Lick Their Slutty-Smelling Pantyhoses. Alice Otsu, Ayaka Mochizuki

  • otsu alice ayaka mochizuki censoredlesbianslutYRLLyuriecchi daydreamersgoro koenjimaniac lesbian lickingYRLL-005YRLL005yrll00005
    • 2021-07-24
    64 min

    FC2PPV 1937865 Super-Dreadnought Eros Hidden In An Ordinary Teenage Girl Who Seems To Be Anywhere. The Body Of The Generalized Erogenous Zone Bends And Cums Just By Touching It. When The Pussy That Is Red-Eyed Is Pursued And The Piston Is Made, A Big

  • amateur uncensoredfc2
    • 2021-09-06
    41 min

    292MY-498 Mitoma honoka 2

  • amateur censoredcreampiebig titsmymy-498my498292my-498
    • 2021-09-11
    241 min

    [UMSO-414]The Y Balance Sex Of A Soft-bodied Beauty!

  • riko kitagawa ririka censoredcreampiebig titsUMSOk m produceumanamiUMSO-414UMSO414umso00414
    • 2021-09-15
    57 min

    SIRO-4629 [First Shot] [Nude Body With Good Proportion] [De M Constitution] Discovered An Interpreter For A Slender Girl With Big Breasts Who Is Fluent In Chinese. A Knowledgeable Lady Who Looks Into Abnormalities Exposes Her Foolery While Drowning I

  • amateur censoredamateursirosiro-4629siro4629siro-4629
    • 2021-10-01
    40 min

    480FRIN-052 《Personal Shooting》 Photobook Release Super Slender G Cup Big Breasts Exclusive Fashion Model Terrestrial Drama Heroine Hidden Camera Leaked Video (Megumi Meguro)

  • amateur censoredcreampiebig titsfrinfrin-052frin052480frin-052
    • 2021-10-07
    161 min

    [SUN-032]Contraceptive Cum D***king An Intellectual Art College S*****t Who Goes Outdoors To D***k Condoms Filled With Cum

  • amemiya kotone censoredbig titssingle workSUNsuntanaka baconSUN-032SUN03213sun00032
    • 2021-10-07
    56 min

    FC2PPV 2306598 18-Year-Old Ubukawa Student Who Wants To Be A Ba. I’m So Excited To Feel It For The First Time In My Life! I Have Vaginal Cum Shot Without Permission.

  • amateur uncensoredfc2
    • 2021-10-15
    150 min

    [BLK-532]She"ll Eat Men Up As She Bares Her Super Carnivorous Sexual Instinct To Prey On Cocks! Let"s Cum With Queen Maria! An Orgasmic Banging Date Maria Nagai

  • maria nagai censoredcreampiebig titsBLKkira kiratorendei yamaguchikira hosi kira black galBLK-532BLK532blk00532
    • 2021-11-01
    65 min

    SIRO-4658 [First Shot] [Slender E-Cup] [Dramatic Service] A Gorgeous Imadoki College Student With A Sense Of Rear Appears. Active Jd Aiming For A Teaching Profession Is Shy But Exposes A Foolery In Front Of The Camera .. AV Application On The Net → A

  • amateur censoredamateursirosiro-4658siro4658siro-4658
    • 2021-12-03
    116 min

    [NNPJ-482]Married Woman Using Social Media - Picking Up Girls Techniques. Ordinary Married Woman That Lives In An Apartment And Just Wears 980 Yen Hoodies Puts On A Kimono And Goes Out On A Special Date, Leading To A Simple Affair With Fucking. Mako

  • censoredcreampieNNPJnampa japanNNPJ-482NNPJ482nnpj00482
    • 2021-12-09
    179 min

    [SUN-039]Lusty Reception Girl. Exhibitionist Presentation With Beauty Who Likes To D***k Anywhere

  • yui hatano censoredsingle workSUNsunbacon tanakaSUN-039SUN03913sun00039
    • 2021-12-13
    100 min

    [SHN-072]Sensitive Nipple Play Groping 2022, Hot Big Tits Wife Gets A Dick In Her Before She Notices / Big Tits Dental Hygienist Secretly Groped And Fucked During Treatment

  • censoredbig titssquirtingSHNnatural highkansukenatsu carefully selected daughterSHN-072SHN0721shn00072
    • 2021-12-24
    65 min

    FC2PPV 2539763 A Beauty Salon Receptionist Who Is Very Popular With Her Uncle [Completed The First Saddle Complementary Plan] Succeeded In Bringing Her To The Hotel Even Though She Hates It! !! It Is Vaginal Cum Shot Covered With Love Juice For Long

  • amateur uncensoredfc2
    • 2021-12-24
    150 min

    [SSIS-272]Shot With 4K Technology - Aika Yumeno . Pure White Gorgeous Body To Enjoy Looking At With An Extreme Level Of Detail And Sensual High-impact Super Close Distance V.

  • yumeno aika censoredsingle workSSISs1 no 1 stylehirokoji osakiSSIS-272SSIS272ssis00272
    • 2021-12-25
    78 min

    [MNSE-027][DIstribution Only] School Uniform JU Nakadashi Individual Filming Yuria Raw Pantyhose Leg Job Pile Driving Cowgirl Press Yuria Hafu

  • yuria hafu censoredcreampieschoolgirlMNSEcrystal eizomaniac plusMNSE-027MNSE027mnse00027
    • 2021-12-29
    65 min

    SIRO-4746 [First Shot] [Whitening Nice Ass] [Eyes Swearing Indecently] A Perverted Married Woman Who Has Been Married But Has Been Told By Saffle To Apply. "I’M Gone Again! !! 』 Unfaithful Piercing Violently ○ Po To Shake Her Legs Jerky .. A

  • amateur censoredmarried womanamateursirosiro-4746siro4746siro-4746
    • 2021-12-31
    149 min

    [MIAA-556]My Female Boss That I Like Is Actually A Snake-tongued Succubus. We Share A Hotel Room On A Business Trip And She Works Out Practically Every Drop Of Cum From Me. Yumi Saeki ka

  • yuka saeki censoredcreampieblowjobMIAAmoodyzham the mceveryone s porn starMIAA-556MIAA556miaa00556
    • 2022-01-08
    126 min

    [CEMD-107]Crying Non-stop Hard Cumming SEX 15 - Mika Kisaragi

  • mika kisaragi censoredmature womansingle workCEMDceleb no tomoCEMD-107CEMD107cemd00107
    • 2022-01-18
    41 min

    H0930 ki220118 Emi Kinoshita 48years old

  • amateur uncensoredh0930
    • 2022-01-20
    180 min

    [OFKU-196]団地妻のフェロモン肉体 欲情中出しSEX

  • rieko hiraoka yuki nanami censoredcreampieOFKUstar paradiseofukuro tetsudouOFKU-196OFKU196h-254ofku00196



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored