javcensored shaved high vision creampie censored




FC2NGODHUNTBEBODNATRCESDCAWDVEMAIPXAPODMIDVABWSSNIMIAAADNMEYDNACRPREDAVSAMIDEFSDSS

2020-09-16
80 min

259LUXU-1316 Luxury TV 1301 Change Job From Gravure To Medical Office! I Still Have A Body That Is Outstandingly Comfortable To Hold, And I Appear In Av Again! Good Blame And Good Reception! The Body Sensitive To Pleasure Straddles The Phallus In Sea

  • amateur censoredcreampiebig titsluxuluxu-1316luxu1316259luxu-1316
    • 2020-10-05
    74 min

    FC2PPV 1523959 [First time limited 1980] [SSS] 22-year-old local supermarket cashier daughter ❤️ A cute girl with a smile like an idol loves H ❤️ Kodomo system and hairless thick masterpiece ❤️ Plenty of mass cum shot ❤️ * With review benefits

  • amateur uncensoredfc2
    • 2020-10-08
    172 min

    [HAWA-225]Unrefusable Big Titted Wife Wants To Fuck You And D***k Your Jizz - After Turning 30 Her Lust Grew Off The Charts And She Turned Into An Exhibitionist Who Wants To Bang Out In The Open Air - 31-Year-Old Yuka, G-Cup

  • censoredbig titssquirtingHAWAcosmos videohide monkcosmospicturesHAWA-225HAWA2251hawa00225
    • 2020-10-08
    163 min

    [HAWA-226]"The Truth Is, I Want To Be Sexually Teased Every Day..." A Dairy Products Sales Lady With An Erotic, Big Ass Kana-san (29 Years Old) She's Making Her Wishes Cum True With An Ass Bukkake And Now She's Satisfied

  • censoredlingerieHAWAcosmos videomountain forestcosmospicturesHAWA-226HAWA2261hawa00226
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-28
    49 min

    FC2PPV 1549507 ★ Appearance ☆ Follower amateur man and erotic older sister Midoriko cum shot for the first time ☆ Grinning Midoriko looking at Bing’s big dick ♥ A large amount of semen cum shot at the end while squirming to the back of the vagin

  • amateur uncensoredfc2
    • 2020-11-01
    121 min

    [NACR-362]A Son's Wife - Rika Aimi

  • rumi tadami censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-362NACR362h-237nacr00362
    • 2020-11-19
    66 min

    [oretd-806]あすか

  • amateur censoredcreampiebig titsoretdoretd-806oretd806oretd-806
    • 2020-12-16
    55 min

    [opcyn-134]まいか(23)

  • amateur censoredcreampiesquirtingopcynopcyn-134opcyn134opcyn-134
    • 2020-12-17
    149 min

    [PPPD-894]Creampie Soapland Brothel Three-Way - Flanked On Both Sides By Busty Sluts Who'll Drain Your Balls Dry With Unlimited Orgasms

  • marin natsuki manami oura censoredbig titsPPPDoppaiPPPD-894PPPD894pppd00894
    • 2020-12-20
    87 min

    345SIMM-577 Cheerful and cute uncle J ○ is a lewd girl who loves ugly things! A thread-pulling love juice that makes your fingers soaked, a confession of Ubu Kawa who is ona with an electric massager imagining H with an uncle, a large amount of urina

  • amateur censoredcreampieuniformsimmsimm-577simm577345simm-577
    • 2020-12-26
    161 min

    [JUKF-052]These Fans Came To This Private Video Session For The No.1 Private Video Idol So She Can Sell Herself And Make Some Extra Money Rika-chan Rika Aimi

  • rumi tadami censoredcreampiebig titsJUKFjumpjump avJUKF-052JUKF052h-227jukf00052
    • 2020-12-30
    60 min

    Caribbeancom 123020-001 Quick Shooting: The Best of Meirin

  • meirin uncensoredcreampiehandjobcaribbeancom
    • 2020-12-31
    88 min

    [ADN-284]How To Seduce A Lonely Married Woman Hijiri Maihara

  • kiyoshi maihara censoredsingle workADNattackerssayaka dateotona no dramaADN-284ADN284adn00284
    • 2020-12-31
    98 min

    [SHKD-925]Sex With My Uncle Karen Otoha

  • karen otoha censoredschoolgirlsingle workSHKDattackerssayaka datesharkSHKD-925SHKD925shkd00925
    • 2021-01-04
    84 min

    Pacopacomama 010421_412 Ayano Honjo

  • ayano honjo uncensoredcreampieblowjobpacopacomama
    • 2021-01-08
    131 min

    [DTT-072]A Married Woman Life Insurance Sales Lady Who Will Accept Any Sexual Demand From Her Customer In Order To Make A Sale Megu Sugizaki 31 Years Old Her Adult Video Debut She's Got Light Skin And A Voluptuous Body And She'll Lure You To

  • meg sugisaki censoredbig titsmature womanDTTprestigeitoman akifumikanbiDTT-072DTT072118dtt00072
    • 2021-01-31
    182 min

    [SQIS-042]Ravished - Sacrificed To Monstrous Lust

  • censoredbig titsmature womanSQISfa proSQIS-042SQIS042sqis00042
    • 2021-02-09
    126 min

    [KTRA-274]Innocent Stepdaughter Creampied Karen Junshin

  • junshin karen censoredsoloworkKTRAk tribeKTRA-274KTRA274
    • 2021-02-13
    48 min

    H4610 ori1748 Saaya Nagato 20years old

  • amateur uncensoredh4610
    • 2021-02-18
    73 min

    [REBD-534]Maria 3 - My Time Will Come - Maria Aine

  • maria aine censoredsingle workREBDrebeccatiger kosakaiREBD-534REBD534h-346rebd00534
    • 2021-02-20
    50 min

    1Pondo 022021_001 Meet and SEX in XX seconds: Miku Aoyama

  • amateur uncensored1pondo
    • 2021-03-12
    54 min

    FC2PPV 1723811 [Uncensored] Super S-class J ● Refre beautiful girl Rina-chan’s back part-time job! Uniform Gachihame seeding creampie press !!: Rina-chan (18 years old)

  • amateur uncensoredfc2
    • 2021-03-12
    67 min

    [orec-714]まりなちゃん

  • amateur censoredcreampieuniformorecorec-714orec714orec-714
    • 2021-03-18
    123 min

    [AKDL-096](Tokyo Girls) Starring In Porn On Her Way Home From Work! Her Pussy Lasts All Night Long - Limitlessly Horny Slut Fucks Like A Machine! When Your Dick Is Done She Sweetly Pleads For More - The No. 1 Girl You'll Want As Your Lover, Massa

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-096AKDL0961akdl00096
    • 2021-04-09
    179 min

    [MIAA-420]My Girlfriend's Chubby Older Sister Opened Up My Ass And Made Me Cum Like A Woman Yuri Honma

  • really censoredbig titsslutMIAAmoodyznao masakieveryone s porn starMIAA-420MIAA420miaa00420
    • 2021-04-10
    117 min

    [HOKS-094]Titties Soft Fruit Ripen To Perfection

  • mitsu hirose rina ayana akari nanara censoredbig titsmature womanHOKSfa prokinzo ogurokkuHOKS-094HOKS094hoks00094
    • 2021-04-15
    247 min

    [NATR-656]Totally! Chie Nakamura

  • tomoe nakamura censoredcreampiebig titsNATRpinknadeshikoNATR-656NATR656natr00656
    • 2021-04-15
    191 min

    [PYM-372]S********l Masturbation Voyeur - 10 Hot Teens Stroking Their Clits With Abandon And Incredible O-Faces vol. 2

  • censoredschoolgirlPYMprimoPYM-372PYM372h-283pym00372
    • 2021-04-22
    146 min

    [TOEN-040]First Time On Film Kept Secret From Husband Porn Debut Shameful Wife With Beautiful Big Tits Naomi Okamoto 50 Years Old

  • naomi okamoto censoredcreampiebig titsTOENcenter villageyoichi sanotaoyuanTOEN-040TOEN040h-086toen00040
    • 2021-04-28
    51 min

    FC2PPV 1792607 A fresh slender girl who just came to Tokyo ❤️ First and last intense Gonzo video [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-09
    61 min

    HEYZO 2518 Pissing MILF Really Loves Anal Drilling – Mikako Tachibana

  • amateur uncensoredcreampieheyzo
    • 2021-05-20
    59 min

    SIRO-4525 [First shot] [Fluffy busty lewd JD] [Even if you die ..] A 20-year-old female college student who is curious. A busty girl who does naughty things with school girls has been passed away by a cock for the first time in a long time .. Applica

  • amateur censoredbig titsamateursirosiro-4525siro4525siro-4525
    • 2021-05-21
    119 min

    [NNPJ-447]I Seduced This Super Cute Gal Who Wanted To Be Popular On Social Media So I Seduced Her By Saying, "I Know A Great Spot For Taking Photos!" And That Got Her Super Excited, And Then We Went With The Flow, And I Fucked Her, And I'

  • censoredcreampieamateurNNPJnanpa japanNNPJ-447NNPJ447nnpj00447
    • 2021-06-04
    120 min

    [PRED-316]The CEO's Secretary Came Onto Me By Teasing Me With Whispered Dirty Talk I'm A Regular Office Worker And She Made Me Cum Inside Of Her Airi Kijima

  • airi kijima censoredcreampieslutPREDpremiumkogoro kindaichielegancePRED-316PRED316pred00316
    • 2021-06-17
    486 min

    [KTSG-013]Clothed Sex Daydream THE Kahanshin Tigers BEST Collection 8 Hours, Part 3

  • even aihara yamamoto miwako censoredbukkakeKTSGlower body tigers delusion grouplower body tigersKTSG-013KTSG013ktsg00013
    • 2021-06-29
    121 min

    [SDDE-650]An Introverted S*****t Makes A Contract With A Succubus And Has Her Slut Debut! She Paralyzes Men With Her H*******m Powers And Turns Them Into Masochists! - Meru Kusumi

  • kusumi censoredcreampiecosplaySDDEsod createdazai chinposenzSDDE-650SDDE6501sdde00650
    • 2021-07-08
    179 min

    [FSDSS-252]The Weekend My Girlfriend Was Away, I Titty-Fucked Her "Friend" And Drenched Her In Cum Moe Amatsuka

  • angel moe censoredbeautiful girlslutFSDSSfalenomaeda ichimonfaleno starFSDSS-252FSDSS2521fsdss00252
    • 2021-07-17
    113 min

    FC2PPV 1926642 CP0112 Beautiful Breasts ★ Beautiful Man ★ Beautiful Anal S Class Half Beauty Av Debut With Cusco From Massive Creampie Uterine Close-Up ❤ Mange ❤ Demon Close-Up ❤ Subjective ❤ 4k60fps ❤ Super High Quality ❤ 10 Turtles

  • amateur uncensoredfc2
    • 2021-07-27
    68 min

    Pacopacomama 072721_507 Take Home A Milf Who Suffers From Sexlessness! Misuzu Nishihara

  • amateur uncensoredpacopacomama
    • 2021-08-06
    183 min

    [IPX-698]FIRST IMPRESSION 149 - The Healing Beauty Mai Kanami

  • kanna mimai censoredsquirtingsingle workIPXidea pocketusapyontissueIPX-698IPX698ipx00698
    • 2021-08-13
    122 min

    [FOCS-017]Visiting The Pink-haired Emo GAL! Revealing Her Lewdness! Spreading Legs To Masturbate And Allowing People To Fuck Her

  • rurucha censoredbeautiful girlsingle workFOCSabc mousou zokufocusFOCS-017FOCS017focs00017
    • 2021-08-21
    138 min

    [FLAV-278]HYPER FETISH High Leg Naughty Queen, Aoi Tojo

  • tojo censoredslutsingle workFLAVdigital arkdigital ark dejitarua kuFLAV-278FLAV278flav00278
    • 2021-09-02
    75 min

    FC2PPV 2089132 [Leaked] Girls Band Vocal K (20) Boyish Big Breasts Diva’S Private Girl’s Face Creampie Gonzo Leaked [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-09-17
    150 min

    [EYAN-173]162x Climaxes! 112x Body Twitches! Squirting 4,000ml! Huge Busty J-cup Married Woman. First-time Creampie And Raw Fucking Climax Documentary. Miki Shiraishi

  • miki shiraishi censoredcreampiebig titsEYANe bodymonhanazakari no tsumatachiEYAN-173EYAN173eyan00173
    • 2021-09-22
    51 min

    [092221-001][VR] An affair partner who likes dangerous play to make a phone call during sex

  • reiko mizuhara uncensoredcreampiecaribbeancom
    • 2021-09-26
    31 min

    FC2PPV 2252860 Until Today! Appearance! "# 6" Company Clerk. Thick Contact By Exchanging Saliva. While Letting Me Say "Put It Inside" … ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-10-01
    64 min

    518ASGM-022 [Sleep Fucking / Intravaginal Ejaculation] Taito-Ku Shaved Girl Hidden Camera (Metropolitan / Ordinary Course) Estimated B Cup

  • amateur censoredcreampieuniformasgmasgm-022asgm022518asgm-022
    • 2021-10-08
    125 min

    [JUL-727]大型専属第4章！！中出し解禁！！ 夫と子作りSEXをした後はいつも義父に中出しされ続けています…。 岸えま

  • ema kishi censoredcreampiebig titsJULmadonnatomitake taroJUL-727JUL727jul00727
    • 2021-10-15
    45 min

    FC2PPV 2345691 [Twin Pregnant Women] Huge Belly! !! I Tried To Bukkake Thick Semen In The Back Of The Vagina Of A Very Rare Pregnant Woman Who Is At Home With Identical Sausage! !!

  • amateur uncensoredfc2
    • 2021-10-15
    150 min

    [PRED-345]A Triple Slut Office Lady Harlem Threat Horny Elder Sister Types Will Hit You With A 3-Point Combo And Make You Creampie Cum, Over And Over Again! Kano Kashii Yui Hatano Himari Kinoshita

  • kashii hanano yui hatano censoredcreampieblowjobPREDpremiumkyouseielegancePRED-345PRED345pred00345
    • 2021-10-17
    59 min

    200GANA-2580 In The Spear Room Of The Nampa Master Of 100 Battles, Bring In Sex Secret Shooting 222 Re-Drink On The Way Home After Drinking! Beautiful Big Tits & Nice Ass Unfussy Girls Brought Home! Outstanding Proportions That Are Cramped Even Th

  • amateur censoredbig titsamateurganagana-2580gana2580200gana-2580
    • 2021-10-21
    272 min

    [SVDVD-885]Shame! Before the Newly Appointed Nurse Takes Up a Post at the Hospital Ward, She Gets a Mandatory Medical Examination. In Autumn 2021, We Were Guinea Pigs for the Medical Interns.

  • mikako horiuchi chaoyang ema censorednurseSVDVDsadistic villageistshuuchi musumeSVDVD-885SVDVD8851svdvd00885
    • 2021-10-23
    241 min

    [MDBK-205]Her Big Smile And Smooth Skin Make Me Crazy!! Modern S********l"s Demands!!! Temptation Best 50 Selection!!!

  • inaba miku abe censoredcreampieslutMDBKbazookataro kMDBK-205MDBK205mdbk00205
    • 2021-10-26
    50 min

    H0930 ki211026 Shizuka Nojima 43years old

  • amateur uncensoredh0930
    • 2021-11-30
    59 min

    FC2PPV 2477221 [First Shot] Continuous Vaginal Cum Shot To A Beautiful Legged Married Woman Who Gave Birth At The Age Of 15 ☆ "My Husband Is A Dump Driver, Spear Mass For Children Because I Have A Bad Income" ☆ I Also Love Rimming ☆ [Personal

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored