javcensored small milk censored high vision jav




FC2MVSDWANZBLKNACXCESDDASDONEZAMBIJULSQTEMIAASHKDPREDMARACHRVFSDSSSANRBDSSISLULU

2020-11-29
127 min

[DLPN-002]The Amateur Maso Volunteer Wife File.01 A Neat And Clean, Seemingly Quiet And Tall Slender Wife Deep Throat/Anal Breaking In Training Anal Destruction/Facial Devastation/Deep Throat Detonation/Every Glory Hole Annihilated

  • censoreddeepthroatDLPNilka emmanuelDLPN-002DLPN002dlpn00002
    • 2020-12-03
    79 min

    [REBD-516]Kanon, Innocent Bitch - Kanon Amane

  • natural kanon censoredsingle workREBDrebeccakure hagaREBD-516REBD516h-346rebd00516
    • 2020-12-17
    240 min

    [DVDMS-609]Faces Shown! One-Way Mirror Flight - Prim Pretty Department Store Clerks Working In The Beauty Department - Their First Deep Kiss Edition - Vol. 02 8 Stars, Everyone Gets Laid Special! Moist, Beautiful Lips Locked In Passionate Hot Smother

  • censoredamateurDVDMSdeepsfunky haseithe magic mirror mm mm flightsDVDMS-609DVDMS609dvdms00609
    • 2020-12-20
    163 min

    [DASD-780]I Work For A Lingerie Manufacturer That Hires Mostly Guys And They Made Me Put On Women's Lingerie. Rui Nanase

  • nanase rui censoredbeautiful girlsingle workDASDdascognac kaminoDASD-780DASD780dasd00780
    • 2021-01-19
    61 min

    1Pondo 011921_001 M Slut : Kurumi Kokoro

  • amateur uncensored1pondo
    • 2021-01-20
    162 min

    [GVH-180]Watching The Sexual Social Studies Tour Of The President's Son 7 - Mako Shion/ Hibiki Otsuki / Yuri Oshikawa

  • miko shion otsuki sound censoredGVHglory questhyonGVH-180GVH18013gvh00180
    • 2021-01-25
    52 min

    FC2PPV 1659353 [First cock 2 simultaneous blowjob ❤ complete appearance] Fcup big breasts girl reappears ☆ Masturbation while blowjob handjob w Oil slimy massage & shrimp shaving with finger man torture Dirty beauty big tits Tayun Tayun! With Ful

  • amateur uncensoredfc2
    • 2021-01-30
    137 min

    [JUFE-252]This Big Tits Wife Is At The Peak Of Womanhood, And Since There's Nothing To Do In The Country But Fuck, I Fucked Her Over And Over Again One Hot, Sweaty Summer, And That's How I Got My Cherry Boy Graduation Yuri Honma

  • really censoredcreampiebig titsJUFEfitchJUFE-252JUFE252jufe00252
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-13
    155 min

    [APOD-044]A Neat And Clean Beauty With 18 Years Of Experience Practicing Ballet Now Appears On An AV! Shameful Play Cumming Outdoors Over And Over Again

  • censoredcreampieamateurAPODapollo delusion groupapollo apollo delusion groupAPOD-044APOD044apod00044
    • 2021-02-19
    50 min

    FC2PPV 1692939 ★ First shot super rare amateur ☆ Natural erotic girl! Duero soul shown in the first shooting ♥ Moeka-chan of active JD 20 years old ☆ It’s too erotic! Continuous ascension Iki rolled ♥ Excited for the first vaginal cum shot ♥ [Pe

  • amateur uncensoredfc2
    • 2021-02-21
    119 min

    [CAWD-177](A Teacher Must Never Commit Herself To Pure Love) She Couldn't Ignore The Needs Of Her Male S*****t, And When He Tickled Her Maternal Instinct, One Night, During A Typhoon, They Hungrily Feasted Upon Each Other Until They Destroyed Eve

  • maiyuki ito censoredcreampiesingle workCAWDkawaiisuisei akaiCAWD-177CAWD177cawd00177
    • 2021-02-26
    35 min

    FC2PPV 1703388 [No mode] Final interview with raw vaginal cum shot of abuse of authority. Misunderstanding job hunting students who dislike blowjobs are sanctioned by Tekken with slap w Then, by the time they lick anal, education is completed and con

  • amateur uncensoredfc2
    • 2021-03-12
    58 min

    FC2PPV 1723707 [First individual shooting] Kanae, a vocational school student, 19 years old. !! [Special Edition]

  • amateur uncensoredfc2
    • 2021-03-13
    50 min

    C0930 ki210314 Ayumi Shoda 28years old

  • amateur uncensoredc0930
    • 2021-03-21
    147 min

    [CAWD-193]They Thought That I Was A Hot Prospect And A Good Catch, So ... These Two New Horny Slut Employees Took Me Home And Took Turns Fucking Me Until My Balls Went Dry In A Reverse Threesome Fuck Fest Kanon Amane Himari Kinoshita

  • natural kanon himari kinoshita himari hanazawa censoredcreampieslutCAWDkawaiikyoseiCAWD-193CAWD193cawd00193
    • 2021-03-25
    121 min

    [RCTD-391]Dirty Talking Female Anchor, 25 Years Old: A Female Announcer With Crazy Habits SP - Sei Maihara

  • kiyoshi maihara censoredbig titssingle workRCTDrockettaro kanbeRCTD-391RCTD3911rctd00391
    • 2021-04-02
    100 min

    [BF-629]The Girl Next Door Is A Horny Slut Who Is Luring Me To Temptation Creampie Cowgirl Semen-Sucking Sex Riho Fujimori

  • riho fujimori censoredcreampiesquirtingBFbefreeBF-629BF629bf00629
    • 2021-04-03
    242 min

    [MMB-356]10 Genuinely Degenerate Housewives Who Were Fooled On April Fools Day And Got Creampie Fucked - Please Don't Make A Fool Out Of Me! You Sexy Housewives! -

  • censoredcreampieMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-356MMB356mmb00356
    • 2021-05-01
    120 min

    [PRED-309]Her Ass Is Susceptible To Suggestion. I Lost My Mind Over That Beautiful Ass Belonging To The Girl Next Door, And I Kept On Pumping Her With Piston-Pounding, Out-Of-Control Creampie Sex ... Kano Kashii

  • kashii hanano censoredcreampiesingle workPREDpremiumeightelegancePRED-309PRED309pred00309
    • 2021-05-07
    120 min

    [MIDE-927]Sexual Stimulation Pussy Rejuvenation Massage Parlor Always Leaves You Satisfied! Shoot Your Load Until Your Balls Are Empty! Rei Futami

  • rei futami censoredslutsingle workMIDEmoodyzwild sevenmoodyz divaMIDE-927MIDE927mide00927
    • 2021-06-01
    120 min

    [NACR-424]The Wife Next Door With Giant Tits Accidentally Entered The Wrong House Yuri Honma

  • really censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-424NACR424h-237nacr00424
    • 2021-06-05
    91 min

    [VENX-043]A Stepmom And Stepson That Have Sex Within 2 Seconds After The Father Leaves The House - Ren Usui

  • usui ren censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-043VENX043venx00043
    • 2021-06-06
    36 min

    FC2PPV 1855564 [Personal shooting] ♀299 Professional student Ma ◯ -chan, 20 years old, 2nd time, will you get pregnant once! ？？ Menstruation stopped at the last seeding conceived AV debut! A vaginal cum shot that doubles as a pregnancy test! (Lol)

  • amateur uncensoredfc2
    • 2021-06-16
    210 min

    [HUNTB-039]"Do You Only Get Horny For Big Tits？ Mine Are Pretty Small, But They're Super Sensitive" My Only Female Friend In School Acts Just Like A Guy, It's So Refreshing!

  • censoredcreampieschoolgirlHUNTBhuntercognac kaminohhh groupHUNTB-039HUNTB039huntb00039
    • 2021-06-20
    127 min

    [BLOR-172]A Shy Girl Who Works At A Stationery Shop This Quiet And Shy Girl Turned Out To Be A Slimy Slut Who Gets Hot And Buttery For Cocks

  • censoredamateurBLORbroccoli mousouzokubroccolibroccoliBLOR-172BLOR172blor00172
    • 2021-06-25
    106 min

    [YSN-553]My Stepdaughter Has Been Learning About The Art Of Persuasion. She Started Asking Me All Kinds Of Things About My Sex Life, And We Both Started To Get Turned On. She Used My Masochistic Personality Against Me, And Fucked Me Until I Didn'

  • mao watanabe really censoredblowjobYSNnonYSN-553YSN553h-127ysn00553
    • 2021-07-01
    78 min

    200GANA-2507 Seriously Nampa, first shot. 1656 Ask JD who picked up in Shibuya to shoot a slightly mature image video! I was dazzled by the rewards, and when I left myself to the flow … I was completely naked! Slender and small! I feel the cute

  • amateur censoredsquirtingamateurganagana-2507gana2507200gana-2507
    • 2021-07-09
    177 min

    [IPX-696]Matsurbation GO TO!! Rather Than Staying Home And Jacking Off Alone, Wouldn't You Rather Cum With Me？ (Let's Do It Together) Airi Kijima

  • airi kijima censoredcreampiesingle workIPXidea pocketinnabartissueIPX-696IPX696ipx00696
    • 2021-07-10
    245 min

    [KDMI-037]Wonderful Queen Amazing

  • ayane sezaki takarada monami censoredKDMImilldopamixKDMI-037KDMI037kdmi00037
    • 2021-07-17
    235 min

    [HMN-017]Meeting Up With My Favorite Fuck Buddy for the First Time in 3 Years, Hottest Slut Ever...Fucked Her from Noon to Sunrise and Ended Up Giving Her Creampies. Akari Mitani.

  • mitani akari censoredcreampiebeautiful girlHMNhon nakabacon tanakaHMN-017HMN017hmn00017
    • 2021-07-20
    68 min

    329EXMU-065 Mao-chan

  • amateur censoredcreampieschoolgirlexmuexmu-065exmu065exmu-065
    • 2021-07-30
    159 min

    [BBAN-337]Rough Lesbian Plan - Confinement In A Small Room, Experiment On Two Barely Legal Girls -

  • mizuki yayoi mao watanabe censoredschoolgirllesbianBBANbibianBBAN-337BBAN337bban00337
    • 2021-07-30
    117 min

    [PRED-333]I"m Sorry! Forgive Me For Having So Much Thick Creampie Sex With Your Frustrated Girlfriend, Even Though You"re Letting Me Stay At Your Place... ! Yu Shinoda

  • shinoda yu censoredcreampiebig titsPREDpremiumkyaputen ebaraelegancePRED-333PRED333pred00333
    • 2021-08-07
    137 min

    [CEAD-356]I Am A Pleasure Fanatic Of A Lewd Masturbator, No. 18. Mei Satsuki.

  • satsuki mei censoredsquirtingmature womanCEADserebu no tomoCEAD-356CEAD356cead00356
    • 2021-08-21
    104 min

    [DANDAN-008]Cheeky Girl Who Made Fun Of Masochists Is Actually A Big Tits Lolita Who Likes Getting Fucked Raw In The Middle Of The Day

  • censoredbig titsbeautiful girlDANDANdandymongolianDANDAN-008DANDAN0081dandan00008
    • 2021-09-04
    29 min

    FC2PPV 2147803 Now It’s A Vivid And Realistic Etch Of A General Man With Big Breasts And A General Girl With Big Breasts ♥ №73 ♥

  • amateur uncensoredfc2
    • 2021-09-05
    35 min

    FC2PPV 2151561 [No Right] Namba High-Priced Assistance ⑬ * Succeeded In Local Mobile Shooting! (It Will Be 3900 After 3400 Until September 20th)

  • amateur uncensoredfc2
    • 2021-09-11
    154 min

    [SCOP-737]I Went To An Illegal No-Panties Oil Massage Parlor Where I Could Cum Until My Balls Went Dry, With No Time Limits, And We Could Both Climax With Pleasure

  • censoredcreampiebig titsSCOPk m producescoop kmpSCOP-737SCOP737scop00737
    • 2021-09-11
    159 min

    [SUPA-593]Bright, Bubbly, Bouncy Babe With Big Tits. You"ll Want To Get Even Closer To Her Spectacular, Nut-Busting Body While She Fucks Hard For Extreme O-Faces! The Juxtaposition Of Sunny Innocence And Down And Dirty Sex Will Blow Your Load For

  • censoredcreampiebig titsSUPAs kyuu shiroutoSUPA-593SUPA593supa00593
    • 2021-09-16
    87 min

    413INST-161 [Urgent Release] Orgy / Individual Shooting 21 Years Old Big Breasts I Tried To Make Her A Yarichin Friend Sleep. A Female College Student Who Looks Innocent For Two Months And Has A Lascivious Body Will Open Her Crotch Even If She Has A

  • amateur censoredcreampiebig titsinstinst-161inst161413inst-161
    • 2021-09-25
    156 min

    [MADV-512]C***dhood Friend That"s Completely Sex Crazed From Breaking In Is Given Over To A Serious Friend. Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMADVcrystal eizoupearlrice sakagamimaniac crystalMADV-512MADV512madv00512
    • 2021-10-05
    58 min

    FC2PPV 2302188 * Until 10/7 6000 ⇒ 2980 ★ First! Orgy 3p ☆ Miraculous Thirty Beauty ♥ Former Race Queen ♥ Extreme Beauty Body ♥ De M Towako 32 Years Old ♥ Sexy Beauty Confirms Meat Urinal With Continuous Vaginal Cum Shot ♥ De Transformation Iki Spree

  • amateur uncensoredfc2
    • 2021-10-06
    136 min

    [GVH-295]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • honoka kimura yuri mizukawa censoredbig titsGVHglory questhyonGVH-295GVH295gvh00295
    • 2021-10-29
    124 min

    [MIAA-519]"Cause The Store Manager Isn"t Allowed To Go Home Today..." Reverse NTR Cheating Scenario After Hours At Work. A Secret Between Just Us Two That My Wife Can"t Know About. I Give Her Endless Creampie Loads While Holding Her H

  • mina kitano censoredcreampiebig titsMIAAmoodyzbiba gonzominna no kikatanMIAA-519MIAA519miaa00519
    • 2021-10-30
    139 min

    [PKPR-004]Completely Private Video! Dreamy Young Lady Who Loves Sex. Staying Over Alone With Mio Mashiro For First Time. Mio Mashiro

  • mio mashiro censoredcreampiebeautiful girlPKPRpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPR-004PKPR004pkpr00004
    • 2021-11-05
    103 min

    [LOL-202]Blowjob Specialty: Family Fun Video Of An Older Brother Who Has Obscene Sexual Intercourse With His Big Breasted Step Sister Hana - Hana Himesaki

  • himesaki hana censoredcreampiebig titsLOLglayzrori senkaLOL-202LOL20212lol00202
    • 2022-01-01
    55 min

    Pacopacomama 010122_582 Happy New Year Orgy Reiko MizuharaHiromi Okura

  • amateur uncensoredpacopacomama
    • 2022-01-11
    48 min

    C0930 ki220111 Michie Maruo 24years old

  • amateur uncensoredc0930
    • 2022-01-12
    271 min

    [HOISW-011]Sweet! Champion 11. BEST S********l! (Super Gorgeous Special) S********l, POV, Amateur Shoot, Amateur, Beautiful Girl, Uniform, Big Tits, Cum Shot On Tongue, Cum Swallowing.

  • censoredbig titsuniformHOISWfresh gordon mousouzokufresh gordonHOISW-011HOISW011hoisw00011
    • 2022-01-22
    120 min

    [SGM-053]Slippery Mature Woman Lesbian Pleasure Eating Intense And Thick Homosexual Moist Copulation Chisato Shoda , Yu Kawakami

  • shota chisato yu kawakami morino morino censoredbig titslesbianSGMglobal media entertainmentkikujiro akabanesuper global mediaSGM-053SGM053sgm00053
    • 2022-02-04
    160 min

    [VEMA-175]Creampie Job Interview With An Older Female Interviewer You Won"t Be Able To Oppose Yuko Shiraki

  • shiraki yuko censoredcreampiebig titsVEMAvenuskaniemegami venusVEMA-175VEMA175vema00175
    • 2022-02-14
    240 min

    [ZOOO-024]Collection Of Sex Between World"s Highest Level Girls And Nippon Danshi ! G-Cup & Goddess Girls! Selected 10 Girls x 4 Hours!

  • kathy haven lara duro censoredamateurZOOOzoooZOOO-024ZOOO024h-1515zooo00024
    • 2022-02-21
    51 min

    FC2PPV 2677411 [Child Of An Extremely Rare Example] Appearance Is Decided Sticking To The Limit! !! Please Do Not Use Other Words.

  • amateur uncensoredfc2
    • 2022-02-24
    44 min

    [494SIKA-134]従順美乳J○をハメ撮り3P フェラ抜き動画

  • amateur censoredcreampieschoolgirlsikasika-134sika134494sika-134
    • 2022-03-10
    164 min

    [MIST-365]Target Her On Her Danger Day!! Welcome To A Soapland Where You Get To Make Babies 36 Hana Himesaki

  • himesaki hana censoredsingle workMISTmr michirusaitaMIST-365MIST3651mist00365



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored